BLASTX nr result
ID: Perilla23_contig00029345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00029345 (380 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076988.1| PREDICTED: nucleolar complex protein 2 homol... 72 1e-10 >ref|XP_011076988.1| PREDICTED: nucleolar complex protein 2 homolog isoform X1 [Sesamum indicum] Length = 717 Score = 72.4 bits (176), Expect = 1e-10 Identities = 40/79 (50%), Positives = 49/79 (62%) Frame = -3 Query: 237 NLQSVXXXXXXXXXXXXXKSPKDGQNDVEETLDNPVAIDNGRXXXXXXXXXXSLDAVFTE 58 +LQSV K+ K GQND+EE +DN V + NGR SLDAVFTE Sbjct: 15 HLQSVLRQRRKTKALFKRKASKGGQNDIEEQVDNSVPLANGRSIECEGIENTSLDAVFTE 74 Query: 57 NEEDEIANASDSDGYLSED 1 N+ DE+A+ASDSDGYL+ED Sbjct: 75 NDMDEVADASDSDGYLTED 93