BLASTX nr result
ID: Perilla23_contig00028982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028982 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844600.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_012844598.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_011091438.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-12 ref|XP_012844599.1| PREDICTED: pentatricopeptide repeat-containi... 74 6e-11 >ref|XP_012844600.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial isoform X3 [Erythranthe guttatus] Length = 767 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/65 (56%), Positives = 43/65 (66%) Frame = -1 Query: 197 QLQILQTVLIQRLKCFKTSSSSYHGHHMLDEMPSRPNVSVHRFMLNLINQNRKHEALNVF 18 +L+ LQ VL+QR K K S S YH HH+ DE+P VSVHRFMLNL+ QN AL VF Sbjct: 8 KLETLQKVLVQRFKHIKNSCSFYHAHHLFDEIPKTTLVSVHRFMLNLVRQNSPGAALGVF 67 Query: 17 KNHLQ 3 K H Q Sbjct: 68 KKHFQ 72 >ref|XP_012844598.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial isoform X1 [Erythranthe guttatus] Length = 786 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/65 (56%), Positives = 43/65 (66%) Frame = -1 Query: 197 QLQILQTVLIQRLKCFKTSSSSYHGHHMLDEMPSRPNVSVHRFMLNLINQNRKHEALNVF 18 +L+ LQ VL+QR K K S S YH HH+ DE+P VSVHRFMLNL+ QN AL VF Sbjct: 27 KLETLQKVLVQRFKHIKNSCSFYHAHHLFDEIPKTTLVSVHRFMLNLVRQNSPGAALGVF 86 Query: 17 KNHLQ 3 K H Q Sbjct: 87 KKHFQ 91 >ref|XP_011091438.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial [Sesamum indicum] gi|747087771|ref|XP_011091439.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial [Sesamum indicum] Length = 763 Score = 77.0 bits (188), Expect = 5e-12 Identities = 40/71 (56%), Positives = 51/71 (71%), Gaps = 2/71 (2%) Frame = -1 Query: 209 MITRQL--QILQTVLIQRLKCFKTSSSSYHGHHMLDEMPSRPNVSVHRFMLNLINQNRKH 36 MITR+L +I +L+Q+ K K S S G+H+LDE P P VSVHRFMLNL+ QNR+ Sbjct: 1 MITRRLKLEIFHKILVQQSKHLKNSCSFSRGYHVLDETPKPPFVSVHRFMLNLLYQNRQG 60 Query: 35 EALNVFKNHLQ 3 EAL+VFK HL+ Sbjct: 61 EALDVFKKHLE 71 >ref|XP_012844599.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial isoform X2 [Erythranthe guttatus] Length = 769 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = -1 Query: 182 QTVLIQRLKCFKTSSSSYHGHHMLDEMPSRPNVSVHRFMLNLINQNRKHEALNVFKNHLQ 3 Q VL+QR K K S S YH HH+ DE+P VSVHRFMLNL+ QN AL VFK H Q Sbjct: 15 QKVLVQRFKHIKNSCSFYHAHHLFDEIPKTTLVSVHRFMLNLVRQNSPGAALGVFKKHFQ 74