BLASTX nr result
ID: Perilla23_contig00028468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028468 (421 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101962.1| PREDICTED: DNA-directed RNA polymerase 1, mi... 65 2e-08 ref|XP_012847643.1| PREDICTED: DNA-directed RNA polymerase 1B, m... 56 9e-06 >ref|XP_011101962.1| PREDICTED: DNA-directed RNA polymerase 1, mitochondrial-like [Sesamum indicum] Length = 792 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +2 Query: 266 MWRNLSKQSCLRRFEILSEFHPSINAFGGVRPSQNSVFGEETTHFQLQSRVN 421 MWRNLS+QS LR+ + L+E HPS+NAF VR Q+S+F E+ T FQ QS VN Sbjct: 1 MWRNLSRQSYLRKLKFLTESHPSLNAFSAVRSPQDSLFVEKATPFQPQSHVN 52 >ref|XP_012847643.1| PREDICTED: DNA-directed RNA polymerase 1B, mitochondrial [Erythranthe guttatus] gi|604316708|gb|EYU28900.1| hypothetical protein MIMGU_mgv1a000798mg [Erythranthe guttata] Length = 983 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = +2 Query: 266 MWRNLSKQSCLRRFEILSEFHPSINAFGGVRPSQNSVFGEETTHFQLQSRVN 421 MWRNLSKQS LR F++ SE HPS NAF + ++S+F E QL+S +N Sbjct: 1 MWRNLSKQSYLRNFKVFSESHPSPNAFSAGKSPKDSIFVENAVPRQLRSCIN 52