BLASTX nr result
ID: Perilla23_contig00028450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028450 (392 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852761.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 84 4e-14 gb|KQL13994.1| hypothetical protein SETIT_025481mg [Setaria ital... 83 9e-14 gb|KQL05522.1| hypothetical protein SETIT_001080mg [Setaria ital... 83 9e-14 dbj|BAS72633.1| Os01g0549700, partial [Oryza sativa Japonica Group] 83 9e-14 gb|KNA19671.1| hypothetical protein SOVF_059300 [Spinacia oleracea] 83 9e-14 gb|KNA04817.1| hypothetical protein SOVF_196220 [Spinacia oleracea] 83 9e-14 ref|XP_004968948.2| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_012700219.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_012462593.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_012462592.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_012451180.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_012445349.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_012445350.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 gb|KJB54997.1| hypothetical protein B456_009G057600 [Gossypium r... 83 9e-14 ref|XP_012477378.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_012477379.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_011081571.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_011081570.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_011070543.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 ref|XP_011070464.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 83 9e-14 >ref|XP_012852761.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Erythranthe guttatus] gi|848907202|ref|XP_012852762.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Erythranthe guttatus] gi|604305504|gb|EYU24648.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata] gi|604305505|gb|EYU24649.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata] Length = 428 Score = 84.0 bits (206), Expect = 4e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS Sbjct: 387 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 428 >gb|KQL13994.1| hypothetical protein SETIT_025481mg [Setaria italica] Length = 180 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 139 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 180 >gb|KQL05522.1| hypothetical protein SETIT_001080mg [Setaria italica] Length = 429 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 388 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 429 >dbj|BAS72633.1| Os01g0549700, partial [Oryza sativa Japonica Group] Length = 231 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 190 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 231 >gb|KNA19671.1| hypothetical protein SOVF_059300 [Spinacia oleracea] Length = 428 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 387 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >gb|KNA04817.1| hypothetical protein SOVF_196220 [Spinacia oleracea] Length = 428 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 387 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_004968948.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Setaria italica] gi|944241215|gb|KQL05523.1| hypothetical protein SETIT_001080mg [Setaria italica] Length = 512 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 471 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 512 >ref|XP_012700219.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 [Setaria italica] gi|835949947|ref|XP_012700220.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 [Setaria italica] gi|944249732|gb|KQL13995.1| hypothetical protein SETIT_025481mg [Setaria italica] gi|944249735|gb|KQL13998.1| hypothetical protein SETIT_025481mg [Setaria italica] Length = 344 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 303 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_012462593.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Gossypium raimondii] Length = 344 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 303 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_012462592.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 [Gossypium raimondii] gi|763815962|gb|KJB82814.1| hypothetical protein B456_013G215200 [Gossypium raimondii] Length = 428 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 387 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_012451180.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Gossypium raimondii] gi|823237044|ref|XP_012451181.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Gossypium raimondii] gi|763798856|gb|KJB65811.1| hypothetical protein B456_010G114300 [Gossypium raimondii] Length = 428 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 387 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_012445349.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Gossypium raimondii] gi|763788003|gb|KJB54999.1| hypothetical protein B456_009G057600 [Gossypium raimondii] Length = 428 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 387 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_012445350.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Gossypium raimondii] gi|763788002|gb|KJB54998.1| hypothetical protein B456_009G057600 [Gossypium raimondii] Length = 379 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 338 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 379 >gb|KJB54997.1| hypothetical protein B456_009G057600 [Gossypium raimondii] Length = 344 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 303 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_012477378.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Gossypium raimondii] gi|763760019|gb|KJB27350.1| hypothetical protein B456_004G292500 [Gossypium raimondii] Length = 428 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 387 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_012477379.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Gossypium raimondii] gi|763760018|gb|KJB27349.1| hypothetical protein B456_004G292500 [Gossypium raimondii] Length = 344 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 303 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_011081571.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Sesamum indicum] Length = 344 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 303 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_011081570.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Sesamum indicum] Length = 428 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 387 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_011070543.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Sesamum indicum] Length = 344 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 303 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_011070464.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 [Sesamum indicum] Length = 428 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 392 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTATYMPS 267 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 387 GLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428