BLASTX nr result
ID: Perilla23_contig00028384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028384 (690 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70913.1| hypothetical protein M569_03846, partial [Genlise... 55 6e-10 ref|XP_012843992.1| PREDICTED: protein EXPORTIN 1A isoform X2 [E... 59 4e-06 ref|XP_011075806.1| PREDICTED: exportin-1-like [Sesamum indicum] 59 4e-06 ref|XP_012843985.1| PREDICTED: protein EXPORTIN 1A isoform X1 [E... 59 4e-06 ref|XP_011084609.1| PREDICTED: exportin-1-like [Sesamum indicum] 58 6e-06 ref|XP_012858380.1| PREDICTED: protein EXPORTIN 1A-like [Erythra... 57 8e-06 >gb|EPS70913.1| hypothetical protein M569_03846, partial [Genlisea aurea] Length = 875 Score = 55.1 bits (131), Expect(2) = 6e-10 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 2/60 (3%) Frame = -2 Query: 317 LSFFALQLSSDEITFRAL***V--FNIILVQILAHEWPAQSRSLIPYLVACAKTNEPIYE 144 +S ++LSSD+++FR V NIILVQIL HEWP + RS IP LVA AKT+E I E Sbjct: 64 ISEVIVKLSSDDVSFRREKFYVNKLNIILVQILKHEWPGRWRSFIPDLVAAAKTSETICE 123 Score = 36.2 bits (82), Expect(2) = 6e-10 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -3 Query: 391 LQDLQNTPDMWLQEVLILSNTK 326 L+DLQ+ PDMWLQ V ILSNT+ Sbjct: 8 LRDLQSNPDMWLQVVHILSNTQ 29 >ref|XP_012843992.1| PREDICTED: protein EXPORTIN 1A isoform X2 [Erythranthe guttatus] Length = 1075 Score = 58.5 bits (140), Expect = 4e-06 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -2 Query: 317 LSFFALQLSSDEITFRA--L***VFNIILVQILAHEWPAQSRSLIPYLVACAKTNEPIYE 144 +S ++LSSDEI+FR L NIILVQIL HEWPA+ RS IP LVA AKT+E I E Sbjct: 97 ISEVIVKLSSDEISFRRERLYVNKLNIILVQILKHEWPARWRSFIPDLVAAAKTSETICE 156 >ref|XP_011075806.1| PREDICTED: exportin-1-like [Sesamum indicum] Length = 1076 Score = 58.5 bits (140), Expect = 4e-06 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -2 Query: 317 LSFFALQLSSDEITFRA--L***VFNIILVQILAHEWPAQSRSLIPYLVACAKTNEPIYE 144 +S ++LSSDEI+FR L NIILVQIL HEWPA+ RS IP LVA AKT+E I E Sbjct: 97 ISEVIVKLSSDEISFRRERLYVNKLNIILVQILKHEWPARWRSFIPDLVAAAKTSETICE 156 >ref|XP_012843985.1| PREDICTED: protein EXPORTIN 1A isoform X1 [Erythranthe guttatus] gi|604347066|gb|EYU45370.1| hypothetical protein MIMGU_mgv1a000558mg [Erythranthe guttata] Length = 1076 Score = 58.5 bits (140), Expect = 4e-06 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -2 Query: 317 LSFFALQLSSDEITFRA--L***VFNIILVQILAHEWPAQSRSLIPYLVACAKTNEPIYE 144 +S ++LSSDEI+FR L NIILVQIL HEWPA+ RS IP LVA AKT+E I E Sbjct: 97 ISEVIVKLSSDEISFRRERLYVNKLNIILVQILKHEWPARWRSFIPDLVAAAKTSETICE 156 >ref|XP_011084609.1| PREDICTED: exportin-1-like [Sesamum indicum] Length = 1067 Score = 57.8 bits (138), Expect = 6e-06 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 2/60 (3%) Frame = -2 Query: 317 LSFFALQLSSDEITFRA--L***VFNIILVQILAHEWPAQSRSLIPYLVACAKTNEPIYE 144 +S ++LSSDEI FR L NIILVQIL HEWPA+ RS IP LVA AKT+E I E Sbjct: 88 ISEVIVKLSSDEICFRRERLYVNKLNIILVQILKHEWPARWRSFIPDLVAAAKTSETICE 147 >ref|XP_012858380.1| PREDICTED: protein EXPORTIN 1A-like [Erythranthe guttatus] gi|604299893|gb|EYU19736.1| hypothetical protein MIMGU_mgv1a000560mg [Erythranthe guttata] Length = 1076 Score = 57.4 bits (137), Expect = 8e-06 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -2 Query: 317 LSFFALQLSSDEITFRA--L***VFNIILVQILAHEWPAQSRSLIPYLVACAKTNEPIYE 144 +S ++LSSD+I+FR L NIILVQIL HEWPA+ RS IP LVA AKT+E I E Sbjct: 97 ISEVIVKLSSDDISFRRERLYVNKLNIILVQILKHEWPARWRSFIPDLVAAAKTSETICE 156