BLASTX nr result
ID: Perilla23_contig00028311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028311 (334 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088238.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 ... 71 9e-22 ref|XP_012836731.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 ... 62 4e-08 gb|EYU37658.1| hypothetical protein MIMGU_mgv1a023023mg, partial... 62 2e-07 >ref|XP_011088238.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 [Sesamum indicum] Length = 712 Score = 70.9 bits (172), Expect(2) = 9e-22 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -2 Query: 135 TAIENNDASGPLFGTWGSSCERKALEGGSRHFYPGASSGSNQPVE 1 T EN DASG FGTWGSSC+RKALEG S FYPG SS SNQP+E Sbjct: 201 TFSENTDASGSSFGTWGSSCKRKALEGTSGQFYPGGSSSSNQPME 245 Score = 59.3 bits (142), Expect(2) = 9e-22 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -1 Query: 334 GRSQNVQNYSSYNLPLNVRPNNRHLRENDCHSGVGVGRPHTLYESG 197 GRS N+QNYSS LNV PN+ +LRE+D H G+G G PH+LY+SG Sbjct: 130 GRSLNLQNYSSNCGSLNVSPNHGNLREHDYHRGLGTGIPHSLYKSG 175 >ref|XP_012836731.1| PREDICTED: E3 ubiquitin-protein ligase MBR2 [Erythranthe guttatus] Length = 586 Score = 62.0 bits (149), Expect(2) = 4e-08 Identities = 30/40 (75%), Positives = 31/40 (77%) Frame = -2 Query: 126 ENNDASGPLFGTWGSSCERKALEGGSRHFYPGASSGSNQP 7 ENND GP FGTWGSSC+RKALE S FYPG SS SNQP Sbjct: 182 ENND--GPPFGTWGSSCKRKALENTSGQFYPGGSSTSNQP 219 Score = 21.9 bits (45), Expect(2) = 4e-08 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -1 Query: 328 SQNVQNYSSYNLPLNVRPNNRHLRENDCHSGVGVGRPHTLYES 200 + N QNYSS + D H + PH+LY+S Sbjct: 118 TSNTQNYSSIH---------------DSHRAIVPKLPHSLYKS 145 >gb|EYU37658.1| hypothetical protein MIMGU_mgv1a023023mg, partial [Erythranthe guttata] Length = 545 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/40 (75%), Positives = 31/40 (77%) Frame = -2 Query: 126 ENNDASGPLFGTWGSSCERKALEGGSRHFYPGASSGSNQP 7 ENND GP FGTWGSSC+RKALE S FYPG SS SNQP Sbjct: 161 ENND--GPPFGTWGSSCKRKALENTSGQFYPGGSSTSNQP 198