BLASTX nr result
ID: Perilla23_contig00028043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028043 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012832732.1| PREDICTED: autophagy-related protein 18g [Er... 57 5e-06 >ref|XP_012832732.1| PREDICTED: autophagy-related protein 18g [Erythranthe guttatus] gi|604348480|gb|EYU46635.1| hypothetical protein MIMGU_mgv1a001030mg [Erythranthe guttata] Length = 908 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 302 HELEIRRKDLLPIYGYFPRARSGWIDRLVPSSAQRIQ 192 HE+EIR+KDLLPI+ FPRARSGWIDR +PS + Q Sbjct: 727 HEVEIRQKDLLPIFDNFPRARSGWIDRSIPSDSNNGQ 763