BLASTX nr result
ID: Perilla23_contig00028012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028012 (478 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831058.1| PREDICTED: protein DJ-1 homolog C [Erythrant... 41 3e-07 >ref|XP_012831058.1| PREDICTED: protein DJ-1 homolog C [Erythranthe guttatus] gi|604343844|gb|EYU42678.1| hypothetical protein MIMGU_mgv1a005922mg [Erythranthe guttata] Length = 464 Score = 41.2 bits (95), Expect(2) = 3e-07 Identities = 27/57 (47%), Positives = 32/57 (56%), Gaps = 11/57 (19%) Frame = -3 Query: 332 PFIK*RSTKPIKIISLNPVIV-----------S*FLVAIGFGMEEMKSVIMIVVLRR 195 P +K RSTKP KIIS P++ LV IG G EEM++VIMI V RR Sbjct: 45 PPLKQRSTKPRKIISPTPILAPASPPPSSPPPKKVLVPIGLGTEEMEAVIMIDVFRR 101 Score = 39.7 bits (91), Expect(2) = 3e-07 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -2 Query: 192 KNLQVEVVVSTKLVVDAFVFACSDETFDLNAL 97 ++L VE TKLV DA + ACSDETFDL AL Sbjct: 113 EHLVVEASGGTKLVADALISACSDETFDLVAL 144