BLASTX nr result
ID: Perilla23_contig00027451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00027451 (568 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010668395.1| PREDICTED: uncharacterized protein LOC104885... 42 4e-07 >ref|XP_010668395.1| PREDICTED: uncharacterized protein LOC104885396, partial [Beta vulgaris subsp. vulgaris] Length = 1044 Score = 42.0 bits (97), Expect(2) = 4e-07 Identities = 17/36 (47%), Positives = 26/36 (72%) Frame = -2 Query: 174 KKKILDEAHRTPYTAHPRSTKMYQGLKRSF*LYGMK 67 K+KIL+EAH +P++ HP K+Y+ LK++F MK Sbjct: 950 KRKILEEAHNSPFSVHPGGNKLYKDLKQTFWWSNMK 985 Score = 38.9 bits (89), Expect(2) = 4e-07 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -1 Query: 253 SKGFTISLDGTLLFKGRICVPNNGIM*KKNL 161 S GF I DGTL F+GR+CVPNN + +K L Sbjct: 924 SPGFVIQEDGTLRFQGRLCVPNNESLKRKIL 954