BLASTX nr result
ID: Perilla23_contig00027428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00027428 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070421.1| PREDICTED: E3 ubiquitin-protein ligase MARCH... 58 3e-06 >ref|XP_011070421.1| PREDICTED: E3 ubiquitin-protein ligase MARCH11 isoform X1 [Sesamum indicum] Length = 233 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/48 (68%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -2 Query: 143 GGSATMVGEFPDFDIEKQQHDGAADGGG-PENAAVAQSQDLVDKVIDV 3 GG+ATM GE D DIEKQ+ DG DGGG EN A QSQDLV+KVIDV Sbjct: 5 GGAATMAGE-TDTDIEKQRTDGGEDGGGLRENIAGGQSQDLVEKVIDV 51