BLASTX nr result
ID: Perilla23_contig00027274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00027274 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012840823.1| PREDICTED: LOW QUALITY PROTEIN: LMBR1 domain... 76 1e-11 ref|XP_009787283.1| PREDICTED: LMBR1 domain-containing protein 2... 76 1e-11 ref|XP_009589378.1| PREDICTED: LMBR1 domain-containing protein 2... 76 1e-11 gb|EYU34579.1| hypothetical protein MIMGU_mgv1a023112mg [Erythra... 76 1e-11 ref|XP_011097533.1| PREDICTED: LMBR1 domain-containing protein 2... 73 7e-11 ref|XP_010266971.1| PREDICTED: LMBR1 domain-containing protein 2... 73 7e-11 ref|XP_010266968.1| PREDICTED: LMBR1 domain-containing protein 2... 73 7e-11 ref|XP_010266961.1| PREDICTED: LMBR1 domain-containing protein 2... 73 7e-11 emb|CDP01513.1| unnamed protein product [Coffea canephora] 72 1e-10 ref|XP_002264408.2| PREDICTED: LMBR1 domain-containing protein 2... 72 2e-10 ref|XP_010652687.1| PREDICTED: uncharacterized protein LOC104879... 72 2e-10 ref|XP_006366223.1| PREDICTED: LMBR1 domain-containing protein 2... 72 2e-10 ref|XP_004240022.1| PREDICTED: LMBR1 domain-containing protein 2... 72 2e-10 ref|XP_012435432.1| PREDICTED: LOW QUALITY PROTEIN: LMBR1 domain... 70 6e-10 gb|KJB48867.1| hypothetical protein B456_008G090800 [Gossypium r... 70 6e-10 ref|XP_012492119.1| PREDICTED: LMBR1 domain-containing protein 2... 70 6e-10 ref|XP_011022830.1| PREDICTED: LMBR1 domain-containing protein 2... 70 6e-10 ref|XP_002310550.2| hypothetical protein POPTR_0007s05030g [Popu... 70 6e-10 ref|XP_010530626.1| PREDICTED: LMBR1 domain-containing protein 2... 70 8e-10 ref|XP_010530625.1| PREDICTED: LMBR1 domain-containing protein 2... 70 8e-10 >ref|XP_012840823.1| PREDICTED: LOW QUALITY PROTEIN: LMBR1 domain-containing protein 2 homolog A-like [Erythranthe guttatus] Length = 740 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+LTLKYFSGPDVPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVILTLKYFSGPDVPRYVFFT 35 >ref|XP_009787283.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A [Nicotiana sylvestris] Length = 738 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+LTLKYFSGPDVPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVILTLKYFSGPDVPRYVFFT 35 >ref|XP_009589378.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A-like [Nicotiana tomentosiformis] Length = 738 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+LTLKYFSGPDVPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVILTLKYFSGPDVPRYVFFT 35 >gb|EYU34579.1| hypothetical protein MIMGU_mgv1a023112mg [Erythranthe guttata] Length = 733 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+LTLKYFSGPDVPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVILTLKYFSGPDVPRYVFFT 35 >ref|XP_011097533.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A [Sesamum indicum] Length = 734 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+ TLKYF+GPDVPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVIFTLKYFAGPDVPRYVFFT 35 >ref|XP_010266971.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A-like isoform X3 [Nelumbo nucifera] Length = 538 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+ TLKYF+GPDVPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVIFTLKYFAGPDVPRYVFFT 35 >ref|XP_010266968.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A-like isoform X2 [Nelumbo nucifera] Length = 633 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+ TLKYF+GPDVPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVIFTLKYFAGPDVPRYVFFT 35 >ref|XP_010266961.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A-like isoform X1 [Nelumbo nucifera] Length = 738 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+ TLKYF+GPDVPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVIFTLKYFAGPDVPRYVFFT 35 >emb|CDP01513.1| unnamed protein product [Coffea canephora] Length = 736 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+LTL+YF+GPDVPRYV+FT Sbjct: 1 MWVFYLISLPLTLGMVILTLRYFAGPDVPRYVYFT 35 >ref|XP_002264408.2| PREDICTED: LMBR1 domain-containing protein 2 homolog A [Vitis vinifera] gi|297741834|emb|CBI33147.3| unnamed protein product [Vitis vinifera] Length = 736 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMVVLTLKYF+GP +PRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVVLTLKYFAGPGIPRYVFFT 35 >ref|XP_010652687.1| PREDICTED: uncharacterized protein LOC104879904 [Vitis vinifera] gi|297741832|emb|CBI33145.3| unnamed protein product [Vitis vinifera] Length = 130 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMVVLTLKYF+GP +PRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVVLTLKYFAGPGIPRYVFFT 35 >ref|XP_006366223.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A-like [Solanum tuberosum] Length = 737 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+ TLKYFSGP+VPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVIWTLKYFSGPEVPRYVFFT 35 >ref|XP_004240022.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A-like [Solanum lycopersicum] Length = 737 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+ TLKYFSGP+VPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVIWTLKYFSGPEVPRYVFFT 35 >ref|XP_012435432.1| PREDICTED: LOW QUALITY PROTEIN: LMBR1 domain-containing protein 2 homolog A [Gossypium raimondii] Length = 585 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+LTL+YF GPDVPRYV FT Sbjct: 1 MWVFYLISLPLTLGMVILTLRYFVGPDVPRYVLFT 35 >gb|KJB48867.1| hypothetical protein B456_008G090800 [Gossypium raimondii] Length = 658 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+LTL+YF GPDVPRYV FT Sbjct: 1 MWVFYLISLPLTLGMVILTLRYFVGPDVPRYVLFT 35 >ref|XP_012492119.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A-like [Gossypium raimondii] gi|763776992|gb|KJB44115.1| hypothetical protein B456_007G235000 [Gossypium raimondii] Length = 735 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMVV TL+YF+GPDVPRYV FT Sbjct: 1 MWVFYLISLPLTLGMVVFTLRYFAGPDVPRYVLFT 35 >ref|XP_011022830.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A isoform X1 [Populus euphratica] Length = 735 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+LT +YF+GP+VPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVILTARYFAGPEVPRYVFFT 35 >ref|XP_002310550.2| hypothetical protein POPTR_0007s05030g [Populus trichocarpa] gi|550334161|gb|EEE91000.2| hypothetical protein POPTR_0007s05030g [Populus trichocarpa] Length = 611 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFYLISLPLTLGMV+LT +YF+GP+VPRYVFFT Sbjct: 1 MWVFYLISLPLTLGMVILTARYFAGPEVPRYVFFT 35 >ref|XP_010530626.1| PREDICTED: LMBR1 domain-containing protein 2 homolog B-like isoform X2 [Tarenaya hassleriana] Length = 648 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFY+ISLPLTLGMV+LTL+YF+GPDVPRYV FT Sbjct: 1 MWVFYMISLPLTLGMVLLTLRYFAGPDVPRYVLFT 35 >ref|XP_010530625.1| PREDICTED: LMBR1 domain-containing protein 2 homolog A-like isoform X1 [Tarenaya hassleriana] Length = 699 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 106 MWVFYLISLPLTLGMVVLTLKYFSGPDVPRYVFFT 2 MWVFY+ISLPLTLGMV+LTL+YF+GPDVPRYV FT Sbjct: 1 MWVFYMISLPLTLGMVLLTLRYFAGPDVPRYVLFT 35