BLASTX nr result
ID: Perilla23_contig00027228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00027228 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012832310.1| PREDICTED: DNA repair protein RAD16 isoform ... 67 5e-09 ref|XP_011095177.1| PREDICTED: transcription termination factor ... 56 9e-06 >ref|XP_012832310.1| PREDICTED: DNA repair protein RAD16 isoform X1 [Erythranthe guttatus] gi|848863079|ref|XP_012832311.1| PREDICTED: DNA repair protein RAD16 isoform X1 [Erythranthe guttatus] Length = 1057 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -3 Query: 123 MTEHVDPLDGVLKLNRRHTVFGGLLDYLRRFSCVISSAFG 4 M +HVDP+D +LK +RRH +FGG+LDYLRRFS V+SSAFG Sbjct: 1 MPDHVDPVDNILKFSRRHAIFGGILDYLRRFSYVVSSAFG 40 >ref|XP_011095177.1| PREDICTED: transcription termination factor 2 [Sesamum indicum] Length = 1059 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 108 DPLDGVLKLNRRHTVFGGLLDYLRRFSCVISSAF 7 D +D +LK +R H++FGG+LDYLRRFSCV+SSAF Sbjct: 3 DHVDSILKFSRGHSIFGGILDYLRRFSCVVSSAF 36