BLASTX nr result
ID: Perilla23_contig00027078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00027078 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095059.1| PREDICTED: ubiquitin-activating enzyme E1 1-... 72 1e-10 ref|XP_012832207.1| PREDICTED: ubiquitin-activating enzyme E1 1-... 60 8e-07 >ref|XP_011095059.1| PREDICTED: ubiquitin-activating enzyme E1 1-like isoform X1 [Sesamum indicum] Length = 1084 Score = 72.4 bits (176), Expect = 1e-10 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -3 Query: 162 MVNSNSSLDFMLPVKRTTAGAELGFVDSSELTKKHCANF 46 MVNSNSSLDFMLPVKRTTAGAELG VD SELTKKHCANF Sbjct: 1 MVNSNSSLDFMLPVKRTTAGAELGVVD-SELTKKHCANF 38 >ref|XP_012832207.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Erythranthe guttatus] Length = 1086 Score = 59.7 bits (143), Expect = 8e-07 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -3 Query: 162 MVNSNSSLDFMLPVKRTTAGAELGFVDSSELTKKHCANF 46 M NSNSS DFMLPVKR TAGA LGFVD SELTKKHC NF Sbjct: 1 MSNSNSSPDFMLPVKR-TAGAALGFVD-SELTKKHCTNF 37