BLASTX nr result
ID: Perilla23_contig00026980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026980 (560 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095886.1| PREDICTED: C2 and GRAM domain-containing pro... 71 4e-10 ref|XP_011095885.1| PREDICTED: C2 and GRAM domain-containing pro... 71 4e-10 ref|XP_012848968.1| PREDICTED: C2 and GRAM domain-containing pro... 69 1e-09 ref|XP_009782111.1| PREDICTED: C2 and GRAM domain-containing pro... 68 3e-09 ref|XP_009617773.1| PREDICTED: C2 and GRAM domain-containing pro... 68 3e-09 ref|XP_010319216.1| PREDICTED: C2 and GRAM domain-containing pro... 67 6e-09 ref|XP_006350247.1| PREDICTED: C2 and GRAM domain-containing pro... 67 6e-09 ref|XP_006350246.1| PREDICTED: C2 and GRAM domain-containing pro... 67 6e-09 gb|EPS61881.1| hypothetical protein M569_12912 [Genlisea aurea] 67 6e-09 emb|CDP04547.1| unnamed protein product [Coffea canephora] 66 1e-08 gb|EPS70354.1| hypothetical protein M569_04402, partial [Genlise... 66 1e-08 gb|KDO78674.1| hypothetical protein CISIN_1g001764mg [Citrus sin... 65 3e-08 gb|KDO78673.1| hypothetical protein CISIN_1g001764mg [Citrus sin... 65 3e-08 gb|KDO78670.1| hypothetical protein CISIN_1g001764mg [Citrus sin... 65 3e-08 gb|KDO78669.1| hypothetical protein CISIN_1g001764mg [Citrus sin... 65 3e-08 ref|XP_006467213.1| PREDICTED: C2 and GRAM domain-containing pro... 65 3e-08 ref|XP_012074817.1| PREDICTED: C2 and GRAM domain-containing pro... 64 4e-08 ref|XP_012074818.1| PREDICTED: C2 and GRAM domain-containing pro... 64 4e-08 ref|XP_007147576.1| hypothetical protein PHAVU_006G136200g [Phas... 63 1e-07 ref|XP_002889456.1| C2 domain-containing protein [Arabidopsis ly... 61 3e-07 >ref|XP_011095886.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform X2 [Sesamum indicum] Length = 1034 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEA+NIPALDPNGFSDPYVKLQLGRQ+F Sbjct: 1 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGRQKF 35 >ref|XP_011095885.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform X1 [Sesamum indicum] Length = 1058 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEA+NIPALDPNGFSDPYVKLQLGRQ+F Sbjct: 1 MKLLVRVIEARNIPALDPNGFSDPYVKLQLGRQKF 35 >ref|XP_012848968.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Erythranthe guttatus] gi|604314935|gb|EYU27641.1| hypothetical protein MIMGU_mgv1a000583mg [Erythranthe guttata] Length = 1058 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 M+LLVRVIEAKNIPALDPNGFSDPYVKLQLG+QR+ Sbjct: 1 MQLLVRVIEAKNIPALDPNGFSDPYVKLQLGKQRY 35 >ref|XP_009782111.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Nicotiana sylvestris] Length = 1052 Score = 68.2 bits (165), Expect = 3e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEAKNIPA+DPNGFSDPYVKL LG+Q+F Sbjct: 1 MKLLVRVIEAKNIPAMDPNGFSDPYVKLSLGKQKF 35 >ref|XP_009617773.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Nicotiana tomentosiformis] Length = 1052 Score = 68.2 bits (165), Expect = 3e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEAKNIPA+DPNGFSDPYVKL LG+Q+F Sbjct: 1 MKLLVRVIEAKNIPAMDPNGFSDPYVKLSLGKQKF 35 >ref|XP_010319216.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 [Solanum lycopersicum] Length = 1054 Score = 67.0 bits (162), Expect = 6e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEA+NIPA+DPNGFSDPYVKL LG+Q+F Sbjct: 1 MKLLVRVIEARNIPAMDPNGFSDPYVKLSLGKQKF 35 >ref|XP_006350247.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like isoform X2 [Solanum tuberosum] Length = 893 Score = 67.0 bits (162), Expect = 6e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEA+NIPA+DPNGFSDPYVKL LG+Q+F Sbjct: 1 MKLLVRVIEARNIPAMDPNGFSDPYVKLSLGKQKF 35 >ref|XP_006350246.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like isoform X1 [Solanum tuberosum] Length = 1052 Score = 67.0 bits (162), Expect = 6e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEA+NIPA+DPNGFSDPYVKL LG+Q+F Sbjct: 1 MKLLVRVIEARNIPAMDPNGFSDPYVKLSLGKQKF 35 >gb|EPS61881.1| hypothetical protein M569_12912 [Genlisea aurea] Length = 604 Score = 67.0 bits (162), Expect = 6e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLV +IEAKNIPALDPNGF DPYVKL+LGRQRF Sbjct: 1 MKLLVSIIEAKNIPALDPNGFCDPYVKLKLGRQRF 35 >emb|CDP04547.1| unnamed protein product [Coffea canephora] Length = 1042 Score = 66.2 bits (160), Expect = 1e-08 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEA++IP +DPNGFSDPYVKLQLG+QRF Sbjct: 1 MKLLVRVIEARDIPPMDPNGFSDPYVKLQLGKQRF 35 >gb|EPS70354.1| hypothetical protein M569_04402, partial [Genlisea aurea] Length = 1011 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKL +RVIEA+NIPALD NGFSDPYVKLQLGRQ+F Sbjct: 1 MKLFIRVIEARNIPALDSNGFSDPYVKLQLGRQKF 35 >gb|KDO78674.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis] Length = 807 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKL+VRVIEA+NIPA+D NG+SDPYV+LQLGRQRF Sbjct: 1 MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRF 35 >gb|KDO78673.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis] Length = 800 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKL+VRVIEA+NIPA+D NG+SDPYV+LQLGRQRF Sbjct: 1 MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRF 35 >gb|KDO78670.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis] Length = 971 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKL+VRVIEA+NIPA+D NG+SDPYV+LQLGRQRF Sbjct: 1 MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRF 35 >gb|KDO78669.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis] Length = 955 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKL+VRVIEA+NIPA+D NG+SDPYV+LQLGRQRF Sbjct: 1 MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRF 35 >ref|XP_006467213.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Citrus sinensis] gi|641859981|gb|KDO78671.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis] gi|641859982|gb|KDO78672.1| hypothetical protein CISIN_1g001764mg [Citrus sinensis] Length = 1016 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKL+VRVIEA+NIPA+D NG+SDPYV+LQLGRQRF Sbjct: 1 MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRF 35 >ref|XP_012074817.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform X1 [Jatropha curcas] Length = 1026 Score = 64.3 bits (155), Expect = 4e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEA+N+PA+D NGFSDPYVK+QLG+QRF Sbjct: 1 MKLLVRVIEARNLPAMDLNGFSDPYVKVQLGKQRF 35 >ref|XP_012074818.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370 isoform X2 [Jatropha curcas] gi|643726967|gb|KDP35532.1| hypothetical protein JCGZ_08970 [Jatropha curcas] Length = 1025 Score = 64.3 bits (155), Expect = 4e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKLLVRVIEA+N+PA+D NGFSDPYVK+QLG+QRF Sbjct: 1 MKLLVRVIEARNLPAMDLNGFSDPYVKVQLGKQRF 35 >ref|XP_007147576.1| hypothetical protein PHAVU_006G136200g [Phaseolus vulgaris] gi|561020799|gb|ESW19570.1| hypothetical protein PHAVU_006G136200g [Phaseolus vulgaris] Length = 1016 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 107 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQRF 3 MKL+VRVIEAKN+P DPNG SDPYV+LQLG+QRF Sbjct: 1 MKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGKQRF 35 >ref|XP_002889456.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335298|gb|EFH65715.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1872 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 110 EMKLLVRVIEAKNIPALDPNGFSDPYVKLQLGRQR 6 EMKL VRV+EA+N+PA+D NGFSDPYV+LQLG+QR Sbjct: 836 EMKLQVRVVEARNLPAMDLNGFSDPYVRLQLGKQR 870