BLASTX nr result
ID: Perilla23_contig00026881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026881 (439 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079372.1| PREDICTED: QWRF motif-containing protein 8 [... 110 4e-22 emb|CDP02839.1| unnamed protein product [Coffea canephora] 70 6e-10 gb|EPS60645.1| hypothetical protein M569_14157, partial [Genlise... 60 8e-07 ref|XP_011083936.1| PREDICTED: QWRF motif-containing protein 8-l... 59 1e-06 ref|XP_009777619.1| PREDICTED: QWRF motif-containing protein 8 [... 59 1e-06 ref|XP_012841100.1| PREDICTED: QWRF motif-containing protein 8 [... 58 3e-06 gb|EYU34328.1| hypothetical protein MIMGU_mgv1a004247mg [Erythra... 58 3e-06 >ref|XP_011079372.1| PREDICTED: QWRF motif-containing protein 8 [Sesamum indicum] gi|747065470|ref|XP_011079373.1| PREDICTED: QWRF motif-containing protein 8 [Sesamum indicum] gi|747065472|ref|XP_011079374.1| PREDICTED: QWRF motif-containing protein 8 [Sesamum indicum] gi|747065474|ref|XP_011079375.1| PREDICTED: QWRF motif-containing protein 8 [Sesamum indicum] gi|747065476|ref|XP_011079377.1| PREDICTED: QWRF motif-containing protein 8 [Sesamum indicum] gi|747065478|ref|XP_011079378.1| PREDICTED: QWRF motif-containing protein 8 [Sesamum indicum] Length = 598 Score = 110 bits (275), Expect = 4e-22 Identities = 64/107 (59%), Positives = 73/107 (68%) Frame = -1 Query: 322 LNRSIDLADRTSKTSSSSHLETGTPSPRILSLDGTNKPLIKSTSDLLMLVSRDERGRALV 143 L+RSIDLAD+TSKTSS S TGTPS R LSLDGT+KPL+KSTSDLLM +SR E G+A+ Sbjct: 228 LSRSIDLADKTSKTSSVSCSGTGTPSLRRLSLDGTSKPLLKSTSDLLMRISRGENGKAMS 287 Query: 142 NGCSVDDXXXXXXXXXXXXXXXXXXLVNAAARPLSIPTLGLFPLSSS 2 NGCS+DD LVNAAAR LS+PT G P S S Sbjct: 288 NGCSLDDGSPRTQKPGSSSSSDRTQLVNAAARALSLPTPGSRPPSPS 334 >emb|CDP02839.1| unnamed protein product [Coffea canephora] Length = 482 Score = 70.1 bits (170), Expect = 6e-10 Identities = 45/110 (40%), Positives = 55/110 (50%) Frame = -1 Query: 361 PSARRLSLDGNPILNRSIDLADRTSKTSSSSHLETGTPSPRILSLDGTNKPLIKSTSDLL 182 PS L N + NRSIDL D+ + SS +G PS R SLDG KPL KS S+LL Sbjct: 92 PSRAGGKLSANTV-NRSIDLGDKAGRNSSLQQSGSGVPSLRRWSLDGMTKPLQKSASNLL 150 Query: 181 MLVSRDERGRALVNGCSVDDXXXXXXXXXXXXXXXXXXLVNAAARPLSIP 32 VS DE G+ ++ CS DD L+NAA R S+P Sbjct: 151 APVSSDEGGKQVIGDCSADDNSLHLHKPVSSSFLERSKLMNAAIRSQSLP 200 >gb|EPS60645.1| hypothetical protein M569_14157, partial [Genlisea aurea] Length = 561 Score = 59.7 bits (143), Expect = 8e-07 Identities = 49/109 (44%), Positives = 58/109 (53%), Gaps = 2/109 (1%) Frame = -1 Query: 322 LNRSI-DLADRTSKTSS-SSHLETGTPSPRILSLDGTNKPLIKSTSDLLMLVSRDERGRA 149 LNRSI DL D+TSK S SS T TPS R LSLDG KP ++S+SDLLM +SRD+ Sbjct: 209 LNRSIVDLFDKTSKFSLLSSSRRTDTPSSRRLSLDGATKPALRSSSDLLMQISRDD---- 264 Query: 148 LVNGCSVDDXXXXXXXXXXXXXXXXXXLVNAAARPLSIPTLGLFPLSSS 2 CS+ +VNAAAR L P G+ P S S Sbjct: 265 ----CSI-------KRLGPSISSDRVQMVNAAARALFTP--GMRPQSPS 300 >ref|XP_011083936.1| PREDICTED: QWRF motif-containing protein 8-like [Sesamum indicum] gi|747073916|ref|XP_011083937.1| PREDICTED: QWRF motif-containing protein 8-like [Sesamum indicum] gi|747073918|ref|XP_011083938.1| PREDICTED: QWRF motif-containing protein 8-like [Sesamum indicum] gi|747073920|ref|XP_011083939.1| PREDICTED: QWRF motif-containing protein 8-like [Sesamum indicum] Length = 830 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/67 (52%), Positives = 43/67 (64%) Frame = -1 Query: 322 LNRSIDLADRTSKTSSSSHLETGTPSPRILSLDGTNKPLIKSTSDLLMLVSRDERGRALV 143 LNR D+ D+ SK SS SH + S R LSLD +KPL KS SDLLMLVS D+ G+ + Sbjct: 466 LNRC-DITDKMSKISSLSHTKMDARSIRRLSLDALSKPLHKSASDLLMLVSFDDSGKEIS 524 Query: 142 NGCSVDD 122 G +DD Sbjct: 525 YGSILDD 531 >ref|XP_009777619.1| PREDICTED: QWRF motif-containing protein 8 [Nicotiana sylvestris] gi|698581716|ref|XP_009777620.1| PREDICTED: QWRF motif-containing protein 8 [Nicotiana sylvestris] Length = 601 Score = 59.3 bits (142), Expect = 1e-06 Identities = 37/67 (55%), Positives = 46/67 (68%) Frame = -1 Query: 322 LNRSIDLADRTSKTSSSSHLETGTPSPRILSLDGTNKPLIKSTSDLLMLVSRDERGRALV 143 +NRS+DL+D+ SK + S + TPS R LSLDG KPL KS+SDLL LVS D+R + V Sbjct: 226 MNRSVDLSDKNSKIAPISR--SVTPSLRRLSLDGYTKPLQKSSSDLLSLVSSDDRVKGRV 283 Query: 142 NGCSVDD 122 SVDD Sbjct: 284 --LSVDD 288 >ref|XP_012841100.1| PREDICTED: QWRF motif-containing protein 8 [Erythranthe guttatus] gi|848881481|ref|XP_012841101.1| PREDICTED: QWRF motif-containing protein 8 [Erythranthe guttatus] Length = 576 Score = 57.8 bits (138), Expect = 3e-06 Identities = 43/107 (40%), Positives = 53/107 (49%) Frame = -1 Query: 322 LNRSIDLADRTSKTSSSSHLETGTPSPRILSLDGTNKPLIKSTSDLLMLVSRDERGRALV 143 LNRS+DL+D+T K +S S R LSLDG +KPL+KS+SDLLM +SR Sbjct: 227 LNRSVDLSDKTGKFTSLSR------PVRRLSLDGASKPLVKSSSDLLMQISR-------- 272 Query: 142 NGCSVDDXXXXXXXXXXXXXXXXXXLVNAAARPLSIPTLGLFPLSSS 2 S+DD L NAAAR L P + P S S Sbjct: 273 ---SIDDSSLQMQRPGSSSSSDRTKLANAAARALLSPATVVRPSSPS 316 >gb|EYU34328.1| hypothetical protein MIMGU_mgv1a004247mg [Erythranthe guttata] Length = 537 Score = 57.8 bits (138), Expect = 3e-06 Identities = 43/107 (40%), Positives = 53/107 (49%) Frame = -1 Query: 322 LNRSIDLADRTSKTSSSSHLETGTPSPRILSLDGTNKPLIKSTSDLLMLVSRDERGRALV 143 LNRS+DL+D+T K +S S R LSLDG +KPL+KS+SDLLM +SR Sbjct: 188 LNRSVDLSDKTGKFTSLSR------PVRRLSLDGASKPLVKSSSDLLMQISR-------- 233 Query: 142 NGCSVDDXXXXXXXXXXXXXXXXXXLVNAAARPLSIPTLGLFPLSSS 2 S+DD L NAAAR L P + P S S Sbjct: 234 ---SIDDSSLQMQRPGSSSSSDRTKLANAAARALLSPATVVRPSSPS 277