BLASTX nr result
ID: Perilla23_contig00026870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026870 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846270.1| PREDICTED: putative late blight resistance p... 45 1e-07 gb|EYU29927.1| hypothetical protein MIMGU_mgv1a021755mg, partial... 45 1e-07 >ref|XP_012846270.1| PREDICTED: putative late blight resistance protein homolog R1B-16 [Erythranthe guttatus] Length = 984 Score = 45.1 bits (105), Expect(2) = 1e-07 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = -1 Query: 188 RIPNICELEVSYCDLGRD-YDEARSYYCPHNLGCFHQLESLACHFHRDSNWRAFALSLTF 12 RI NI +LE+ Y D+ + YD C +N+ H+LESL HF + N L+LTF Sbjct: 638 RIANIKKLEIVYYDVSEELYDN-----CLYNIDKLHKLESLYYHFDDEPNRSDLLLNLTF 692 Query: 11 PSS 3 PSS Sbjct: 693 PSS 695 Score = 37.4 bits (85), Expect(2) = 1e-07 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = -3 Query: 372 EIWEMSELRHIEVDPLCLVDPLPMDDSSDEEAKDMILRNL 253 EIW M +LRH+E+ +CL DP D D+ ++LR+L Sbjct: 584 EIWSMRQLRHVELGEICLPDPPSSDGQHDDV---IVLRDL 620 >gb|EYU29927.1| hypothetical protein MIMGU_mgv1a021755mg, partial [Erythranthe guttata] Length = 842 Score = 45.1 bits (105), Expect(2) = 1e-07 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = -1 Query: 188 RIPNICELEVSYCDLGRD-YDEARSYYCPHNLGCFHQLESLACHFHRDSNWRAFALSLTF 12 RI NI +LE+ Y D+ + YD C +N+ H+LESL HF + N L+LTF Sbjct: 638 RIANIKKLEIVYYDVSEELYDN-----CLYNIDKLHKLESLYYHFDDEPNRSDLLLNLTF 692 Query: 11 PSS 3 PSS Sbjct: 693 PSS 695 Score = 37.4 bits (85), Expect(2) = 1e-07 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = -3 Query: 372 EIWEMSELRHIEVDPLCLVDPLPMDDSSDEEAKDMILRNL 253 EIW M +LRH+E+ +CL DP D D+ ++LR+L Sbjct: 584 EIWSMRQLRHVELGEICLPDPPSSDGQHDDV---IVLRDL 620