BLASTX nr result
ID: Perilla23_contig00026767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026767 (474 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39590.1| hypothetical protein MIMGU_mgv1a0101821mg, partia... 62 1e-07 >gb|EYU39590.1| hypothetical protein MIMGU_mgv1a0101821mg, partial [Erythranthe guttata] Length = 183 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 127 LATSLHLPKQQQIDRIVKLPGQPSNVKFSQYSGYVTVNNNP 5 ++T+ PKQQ +D+I KLPGQPS+VKFSQYSGY+ VN NP Sbjct: 19 ISTTPPYPKQQALDKITKLPGQPSSVKFSQYSGYIKVNENP 59