BLASTX nr result
ID: Perilla23_contig00026588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026588 (431 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087684.1| PREDICTED: uncharacterized protein LOC105169... 90 7e-16 ref|XP_012850326.1| PREDICTED: bromodomain-containing protein 3 ... 79 1e-12 emb|CDO97612.1| unnamed protein product [Coffea canephora] 63 7e-08 ref|XP_009596406.1| PREDICTED: transcription factor GTE8 [Nicoti... 59 1e-06 emb|CAN68216.1| hypothetical protein VITISV_008346 [Vitis vinifera] 59 1e-06 ref|XP_010657988.1| PREDICTED: bromodomain-containing factor 1-l... 58 2e-06 ref|XP_009783493.1| PREDICTED: bromodomain-containing protein 4 ... 58 2e-06 ref|XP_009783492.1| PREDICTED: bromodomain-containing protein 4 ... 58 2e-06 emb|CBI29708.3| unnamed protein product [Vitis vinifera] 58 2e-06 >ref|XP_011087684.1| PREDICTED: uncharacterized protein LOC105169093 [Sesamum indicum] gi|747080837|ref|XP_011087685.1| PREDICTED: uncharacterized protein LOC105169093 [Sesamum indicum] Length = 579 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/62 (70%), Positives = 52/62 (83%) Frame = -3 Query: 186 MKRRCGSKKGRPKKPKLGISTNEVASTAVSLNTEENSALDEFDNDDVDSGMDAEAETETT 7 MKR+ G+KKGR KKPKL +STNEVAS VSLNTEENS +DEFDN+++DSGMDAE E + Sbjct: 1 MKRKRGNKKGRAKKPKL-VSTNEVASNVVSLNTEENSGVDEFDNEEIDSGMDAETEATPS 59 Query: 6 PS 1 PS Sbjct: 60 PS 61 >ref|XP_012850326.1| PREDICTED: bromodomain-containing protein 3 [Erythranthe guttatus] gi|848900342|ref|XP_012850327.1| PREDICTED: bromodomain-containing protein 3 [Erythranthe guttatus] gi|848900344|ref|XP_012850328.1| PREDICTED: bromodomain-containing protein 3 [Erythranthe guttatus] gi|848900346|ref|XP_012850329.1| PREDICTED: bromodomain-containing protein 3 [Erythranthe guttatus] gi|604313148|gb|EYU26479.1| hypothetical protein MIMGU_mgv1a003392mg [Erythranthe guttata] Length = 588 Score = 79.3 bits (194), Expect = 1e-12 Identities = 41/62 (66%), Positives = 50/62 (80%) Frame = -3 Query: 186 MKRRCGSKKGRPKKPKLGISTNEVASTAVSLNTEENSALDEFDNDDVDSGMDAEAETETT 7 MKRR G+KKG+ KKPKL TNEV S +S+NTE+NS LDEFDN+++DSGM+ AETE T Sbjct: 1 MKRRRGNKKGKAKKPKLA-PTNEVPSNVISVNTEDNSGLDEFDNEEMDSGMN--AETEKT 57 Query: 6 PS 1 PS Sbjct: 58 PS 59 >emb|CDO97612.1| unnamed protein product [Coffea canephora] Length = 592 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/58 (51%), Positives = 43/58 (74%) Frame = -3 Query: 183 KRRCGSKKGRPKKPKLGISTNEVASTAVSLNTEENSALDEFDNDDVDSGMDAEAETET 10 +RR G KKG+ KKP+ +STNEVA + V+ NTE+N ++E DND+ DSG +AE+ + T Sbjct: 3 RRRKGGKKGKAKKPRT-LSTNEVAQSLVTSNTEDNPVMNELDNDEFDSGPEAESPSST 59 >ref|XP_009596406.1| PREDICTED: transcription factor GTE8 [Nicotiana tomentosiformis] gi|697101502|ref|XP_009596412.1| PREDICTED: transcription factor GTE8 [Nicotiana tomentosiformis] gi|697101504|ref|XP_009596419.1| PREDICTED: transcription factor GTE8 [Nicotiana tomentosiformis] Length = 573 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/59 (52%), Positives = 40/59 (67%) Frame = -3 Query: 186 MKRRCGSKKGRPKKPKLGISTNEVASTAVSLNTEENSALDEFDNDDVDSGMDAEAETET 10 MKRR GS+KG+ KKP+ T+E A S+NTE NS +E DND VDSG++AE + T Sbjct: 1 MKRRRGSRKGKAKKPRT-TGTSEEAPNNGSMNTETNSGTEESDNDGVDSGVEAETPSST 58 >emb|CAN68216.1| hypothetical protein VITISV_008346 [Vitis vinifera] Length = 1253 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/62 (45%), Positives = 42/62 (67%) Frame = -3 Query: 195 QE*MKRRCGSKKGRPKKPKLGISTNEVASTAVSLNTEENSALDEFDNDDVDSGMDAEAET 16 +E MKR+ G KKG+ K+P + + N+ AVSLN E+NS LD++DN + DSGM+ + + Sbjct: 693 KENMKRKRGHKKGKAKRPPV-MGANDTFQNAVSLNIEDNSGLDDYDNAEFDSGMEVDTPS 751 Query: 15 ET 10 T Sbjct: 752 ST 753 >ref|XP_010657988.1| PREDICTED: bromodomain-containing factor 1-like [Vitis vinifera] gi|731411457|ref|XP_010657989.1| PREDICTED: bromodomain-containing factor 1-like [Vitis vinifera] Length = 618 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/59 (45%), Positives = 40/59 (67%) Frame = -3 Query: 186 MKRRCGSKKGRPKKPKLGISTNEVASTAVSLNTEENSALDEFDNDDVDSGMDAEAETET 10 MKR+ G KKG+ K+P + + N+ AVSLN E+NS LD++DN + DSGM+ + + T Sbjct: 1 MKRKRGHKKGKAKRPPV-MGANDTFQNAVSLNIEDNSGLDDYDNAEFDSGMEVDTPSST 58 >ref|XP_009783493.1| PREDICTED: bromodomain-containing protein 4 isoform X2 [Nicotiana sylvestris] gi|698469064|ref|XP_009783494.1| PREDICTED: bromodomain-containing protein 4 isoform X2 [Nicotiana sylvestris] Length = 573 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/59 (52%), Positives = 39/59 (66%) Frame = -3 Query: 186 MKRRCGSKKGRPKKPKLGISTNEVASTAVSLNTEENSALDEFDNDDVDSGMDAEAETET 10 MKRR GSKKG KKP+ T+E A S+NTE NS ++ DND VDSG++AE + T Sbjct: 1 MKRRRGSKKGNAKKPRT-TGTSEDAPNNGSMNTETNSGTEDSDNDGVDSGVEAETPSST 58 >ref|XP_009783492.1| PREDICTED: bromodomain-containing protein 4 isoform X1 [Nicotiana sylvestris] Length = 574 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/59 (52%), Positives = 39/59 (66%) Frame = -3 Query: 186 MKRRCGSKKGRPKKPKLGISTNEVASTAVSLNTEENSALDEFDNDDVDSGMDAEAETET 10 MKRR GSKKG KKP+ T+E A S+NTE NS ++ DND VDSG++AE + T Sbjct: 2 MKRRRGSKKGNAKKPRT-TGTSEDAPNNGSMNTETNSGTEDSDNDGVDSGVEAETPSST 59 >emb|CBI29708.3| unnamed protein product [Vitis vinifera] Length = 637 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/59 (45%), Positives = 40/59 (67%) Frame = -3 Query: 186 MKRRCGSKKGRPKKPKLGISTNEVASTAVSLNTEENSALDEFDNDDVDSGMDAEAETET 10 MKR+ G KKG+ K+P + + N+ AVSLN E+NS LD++DN + DSGM+ + + T Sbjct: 1 MKRKRGHKKGKAKRPPV-MGANDTFQNAVSLNIEDNSGLDDYDNAEFDSGMEVDTPSST 58