BLASTX nr result
ID: Perilla23_contig00026516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026516 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlise... 39 3e-06 >gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlisea aurea] Length = 88 Score = 38.9 bits (89), Expect(2) = 3e-06 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +3 Query: 201 MEPAWYLTRHSNRTEPLVKLLFS*SYYGVRHRFLNKIHF*IVW 329 ++ ++ HSNRT+P V LLFS S YGVRHR ++I W Sbjct: 26 VDGVYFCFGHSNRTKPFVMLLFSQS-YGVRHRLQDQISIDFEW 67 Score = 38.9 bits (89), Expect(2) = 3e-06 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +2 Query: 326 MADSPEKHWRACKRAALPTE 385 M +SPEK WRACKR ALPTE Sbjct: 68 MMESPEKPWRACKRGALPTE 87