BLASTX nr result
ID: Perilla23_contig00026430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026430 (434 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012830908.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >ref|XP_012830908.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 [Erythranthe guttatus] Length = 630 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/64 (50%), Positives = 46/64 (71%) Frame = -2 Query: 433 NILLSLAKTAEEQIEAKQLLENQQLSRVLNSVEVEDDDACESDMLEDEFDELLTNSSSEQ 254 NILLSLAKTAEEQ EAKQ++E+ L R+LN+ VEDDD + D D+ D++ S+ ++ Sbjct: 495 NILLSLAKTAEEQTEAKQIVESLSLDRILNN--VEDDDVIDDD---DDDDDVSGVSADQK 549 Query: 253 MQNV 242 +N+ Sbjct: 550 AKNI 553