BLASTX nr result
ID: Perilla23_contig00026363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026363 (372 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012855293.1| PREDICTED: probable nucleoredoxin 1 isoform ... 64 6e-08 gb|EYU22494.1| hypothetical protein MIMGU_mgv1a005241mg [Erythra... 64 6e-08 ref|XP_012855292.1| PREDICTED: probable nucleoredoxin 1 isoform ... 64 6e-08 ref|XP_011071086.1| PREDICTED: probable nucleoredoxin 1 [Sesamum... 62 2e-07 >ref|XP_012855293.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Erythranthe guttatus] Length = 567 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +3 Query: 252 QVETTNGDGPFDLGSILCSPNRDYLVRNNGDQVKADSLKG 371 ++E NGD +DL SIL SPNRDYLVRNNGDQVK DS KG Sbjct: 4 ELEIANGDATYDLSSILSSPNRDYLVRNNGDQVKFDSFKG 43 >gb|EYU22494.1| hypothetical protein MIMGU_mgv1a005241mg [Erythranthe guttata] Length = 492 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +3 Query: 252 QVETTNGDGPFDLGSILCSPNRDYLVRNNGDQVKADSLKG 371 ++E NGD +DL SIL SPNRDYLVRNNGDQVK DS KG Sbjct: 4 ELEIANGDATYDLSSILSSPNRDYLVRNNGDQVKFDSFKG 43 >ref|XP_012855292.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Erythranthe guttatus] gi|604302968|gb|EYU22493.1| hypothetical protein MIMGU_mgv1a003730mg [Erythranthe guttata] Length = 567 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +3 Query: 252 QVETTNGDGPFDLGSILCSPNRDYLVRNNGDQVKADSLKG 371 ++E NGD +DL SIL SPNRDYLVRNNGDQVK DS KG Sbjct: 4 ELEIANGDATYDLSSILSSPNRDYLVRNNGDQVKFDSFKG 43 >ref|XP_011071086.1| PREDICTED: probable nucleoredoxin 1 [Sesamum indicum] Length = 585 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 252 QVETTNGDGPFDLGSILCSPNRDYLVRNNGDQVKADSLKG 371 ++E TN D +DL SILC PNRD+LVRNNGDQV+ DSL+G Sbjct: 8 ELERTNEDKKYDLASILCVPNRDFLVRNNGDQVRVDSLRG 47