BLASTX nr result
ID: Perilla23_contig00026358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026358 (407 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848215.1| PREDICTED: F-box/kelch-repeat protein At5g15... 77 7e-12 emb|CDP02354.1| unnamed protein product [Coffea canephora] 62 2e-07 ref|XP_011099056.1| PREDICTED: F-box/kelch-repeat protein At5g15... 61 4e-07 ref|XP_011077981.1| PREDICTED: F-box/kelch-repeat protein At5g15... 59 1e-06 >ref|XP_012848215.1| PREDICTED: F-box/kelch-repeat protein At5g15710 [Erythranthe guttatus] gi|604315841|gb|EYU28406.1| hypothetical protein MIMGU_mgv1a006659mg [Erythranthe guttata] Length = 436 Score = 76.6 bits (187), Expect = 7e-12 Identities = 42/54 (77%), Positives = 44/54 (81%), Gaps = 2/54 (3%) Frame = -2 Query: 157 MIELGEASEPGARM--LTGRLVRSGSFSEEERFLRQASFGGSGSRNTGPLSRMG 2 MIE+GEASE G+R T RLVRS SFSEEE F RQASFGGSGSRNT PLSRMG Sbjct: 1 MIEIGEASESGSRTPSSTCRLVRSSSFSEEESFHRQASFGGSGSRNTSPLSRMG 54 >emb|CDP02354.1| unnamed protein product [Coffea canephora] Length = 438 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = -2 Query: 157 MIELGEASEPGARMLTGRLVRSGSFSEEERFLRQA-SFGGSGSRNTGPLSRMG 2 M+E+G++SE G R+ RLVR+G EE+ F RQA +FGGSGSRNT PL R+G Sbjct: 1 MVEVGQSSESGFRLPYSRLVRNGVLREEDSFQRQATNFGGSGSRNTSPLGRIG 53 >ref|XP_011099056.1| PREDICTED: F-box/kelch-repeat protein At5g15710 [Sesamum indicum] gi|747101829|ref|XP_011099057.1| PREDICTED: F-box/kelch-repeat protein At5g15710 [Sesamum indicum] gi|747101831|ref|XP_011099058.1| PREDICTED: F-box/kelch-repeat protein At5g15710 [Sesamum indicum] gi|747101833|ref|XP_011099059.1| PREDICTED: F-box/kelch-repeat protein At5g15710 [Sesamum indicum] gi|747101835|ref|XP_011099061.1| PREDICTED: F-box/kelch-repeat protein At5g15710 [Sesamum indicum] Length = 434 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/49 (65%), Positives = 34/49 (69%) Frame = -2 Query: 148 LGEASEPGARMLTGRLVRSGSFSEEERFLRQASFGGSGSRNTGPLSRMG 2 +GEASE G R LVR+ S EEE F RQASFG SGSRNT PL RMG Sbjct: 1 MGEASESGLRTSCSGLVRTSSSREEEIFHRQASFGSSGSRNTSPLGRMG 49 >ref|XP_011077981.1| PREDICTED: F-box/kelch-repeat protein At5g15710-like [Sesamum indicum] Length = 419 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -2 Query: 103 LVRSGSFSEEERFLRQASFGGSGSRNTGPLSRMG 2 +VRSGSFSEEE F RQASFGG GSRNT PL RMG Sbjct: 1 MVRSGSFSEEENFHRQASFGGGGSRNTSPLGRMG 34