BLASTX nr result
ID: Perilla23_contig00026321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026321 (461 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101609.1| PREDICTED: putative lysine-specific demethyl... 85 2e-14 >ref|XP_011101609.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum indicum] gi|747106624|ref|XP_011101610.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum indicum] gi|747106626|ref|XP_011101611.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum indicum] gi|747106628|ref|XP_011101612.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum indicum] gi|747106630|ref|XP_011101613.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum indicum] gi|747106632|ref|XP_011101615.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Sesamum indicum] Length = 1258 Score = 85.1 bits (209), Expect = 2e-14 Identities = 58/142 (40%), Positives = 74/142 (52%), Gaps = 5/142 (3%) Frame = -1 Query: 422 ASDKSEKKQSSFSEHKDIILLSDDEENEPPSKKLCVVKGTSQKDTISIQKPMSLDSMTNL 243 AS+K E Q S+ +KD+ILLSDDE ++P SK+ V K S+K T S+QKP+ +M +L Sbjct: 815 ASEKPEGNQLSYPGNKDVILLSDDEGDQP-SKEPSVEKEASEKHTGSVQKPVCPANMVSL 873 Query: 242 DSRINKPASMTTVTVPSA-----ACFPSSTCIKVDKHVEAEXXXXXXXXXXXSCVNISLM 78 S I PAS TTVT P S C KV+ H SC Sbjct: 874 SSCIRNPASTTTVTGPCVIPDILKQGSSIECPKVEDHAAETERYLGVNSLSSSCSKFPST 933 Query: 77 DTDSKKDVQRNKETNDYDEANA 12 D+DS K + KET + DEANA Sbjct: 934 DSDSSKHAPKKKETPNCDEANA 955