BLASTX nr result
ID: Perilla23_contig00026157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00026157 (513 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075511.1| PREDICTED: 50S ribosomal protein L18, chloro... 80 6e-13 ref|XP_012847534.1| PREDICTED: 50S ribosomal protein L18, chloro... 72 2e-10 ref|XP_007046073.1| Ribosomal L18p/L5e family protein isoform 1 ... 59 2e-06 ref|XP_002312248.1| hypothetical protein POPTR_0008s08680g [Popu... 58 3e-06 ref|XP_006379666.1| hypothetical protein POPTR_0008s08680g [Popu... 58 3e-06 >ref|XP_011075511.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Sesamum indicum] Length = 165 Score = 80.1 bits (196), Expect = 6e-13 Identities = 43/68 (63%), Positives = 49/68 (72%), Gaps = 3/68 (4%) Frame = -1 Query: 195 MAITSCIDALRFRACGIFGNRLSSSNTLPLRPANLFMK---IEGRANQRLESAKISIRRS 25 MAI SCI AL+F+ACGIFG L++ N LPL ANL MK IE RAN R + AK+ RR Sbjct: 1 MAIGSCIAALKFQACGIFGTSLNNLNILPLHSANLVMKPSVIEARANTRTDGAKLQNRRL 60 Query: 24 RKKFNGTA 1 RKKFNGTA Sbjct: 61 RKKFNGTA 68 >ref|XP_012847534.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Erythranthe guttatus] gi|848894988|ref|XP_012847535.1| PREDICTED: 50S ribosomal protein L18, chloroplastic [Erythranthe guttatus] gi|604316575|gb|EYU28767.1| hypothetical protein MIMGU_mgv1a015179mg [Erythranthe guttata] Length = 165 Score = 71.6 bits (174), Expect = 2e-10 Identities = 41/68 (60%), Positives = 47/68 (69%), Gaps = 3/68 (4%) Frame = -1 Query: 195 MAITSCIDALRFRACGIFGNRLSSSNTLPLRPANLF---MKIEGRANQRLESAKISIRRS 25 MA+ S I AL+F+ACGIFG L+SSN LPL AN+ + IE RA R ES KI RRS Sbjct: 1 MAMGSSIAALKFQACGIFGTGLNSSNILPLHSANMVRMPLVIEARAPMRTESDKIRNRRS 60 Query: 24 RKKFNGTA 1 KKFNGTA Sbjct: 61 SKKFNGTA 68 >ref|XP_007046073.1| Ribosomal L18p/L5e family protein isoform 1 [Theobroma cacao] gi|590700103|ref|XP_007046074.1| Ribosomal L18p/L5e family protein isoform 1 [Theobroma cacao] gi|590700106|ref|XP_007046075.1| Ribosomal L18p/L5e family protein isoform 1 [Theobroma cacao] gi|508710008|gb|EOY01905.1| Ribosomal L18p/L5e family protein isoform 1 [Theobroma cacao] gi|508710009|gb|EOY01906.1| Ribosomal L18p/L5e family protein isoform 1 [Theobroma cacao] gi|508710010|gb|EOY01907.1| Ribosomal L18p/L5e family protein isoform 1 [Theobroma cacao] Length = 171 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = -1 Query: 177 IDALRFRACGIFGNRLSSSNTLPLRPANLFMK---IEGRANQRLESAKISIRRSRKKFNG 7 + AL+F+ C + G+ N LPL+ NLF+K +E +AN R ESAKI RR RKKFNG Sbjct: 13 VPALQFKTCDVLGSNSKCLNFLPLQNRNLFVKTLVVEAKANTRTESAKIRNRRMRKKFNG 72 >ref|XP_002312248.1| hypothetical protein POPTR_0008s08680g [Populus trichocarpa] gi|222852068|gb|EEE89615.1| hypothetical protein POPTR_0008s08680g [Populus trichocarpa] Length = 165 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 3/67 (4%) Frame = -1 Query: 195 MAITSCIDALRFRACGIFGNRLSSSNTLPLRPANLFMKI---EGRANQRLESAKISIRRS 25 MA+ S AL F+ C +FGN L N LP++ N K + RAN R ESAKI RR+ Sbjct: 1 MAVRSVPSALPFKTCDVFGNPLKPFNFLPIQTRNFQTKTLVAKRRANTRTESAKIRNRRT 60 Query: 24 RKKFNGT 4 KKFNGT Sbjct: 61 LKKFNGT 67 >ref|XP_006379666.1| hypothetical protein POPTR_0008s08680g [Populus trichocarpa] gi|550332676|gb|ERP57463.1| hypothetical protein POPTR_0008s08680g [Populus trichocarpa] Length = 210 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 3/67 (4%) Frame = -1 Query: 195 MAITSCIDALRFRACGIFGNRLSSSNTLPLRPANLFMKI---EGRANQRLESAKISIRRS 25 MA+ S AL F+ C +FGN L N LP++ N K + RAN R ESAKI RR+ Sbjct: 46 MAVRSVPSALPFKTCDVFGNPLKPFNFLPIQTRNFQTKTLVAKRRANTRTESAKIRNRRT 105 Query: 24 RKKFNGT 4 KKFNGT Sbjct: 106 LKKFNGT 112