BLASTX nr result
ID: Perilla23_contig00025233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00025233 (367 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18733.1| unnamed protein product [Coffea canephora] 92 2e-16 ref|XP_011082955.1| PREDICTED: citrate synthase, glyoxysomal [Se... 88 2e-15 gb|KMT01774.1| hypothetical protein BVRB_9g210550 [Beta vulgaris... 86 1e-14 ref|XP_010689947.1| PREDICTED: citrate synthase, glyoxysomal [Be... 86 1e-14 ref|XP_012844318.1| PREDICTED: citrate synthase, glyoxysomal-lik... 84 5e-14 ref|XP_006448012.1| hypothetical protein CICLE_v10014944mg [Citr... 84 5e-14 ref|XP_010915459.1| PREDICTED: citrate synthase, glyoxysomal-lik... 83 9e-14 gb|KNA09875.1| hypothetical protein SOVF_149620, partial [Spinac... 82 1e-13 ref|XP_006847773.1| PREDICTED: citrate synthase, glyoxysomal [Am... 82 2e-13 ref|XP_009596417.1| PREDICTED: citrate synthase, glyoxysomal-lik... 82 2e-13 ref|XP_008812537.1| PREDICTED: citrate synthase, glyoxysomal [Ph... 82 2e-13 ref|XP_009779039.1| PREDICTED: citrate synthase, glyoxysomal-lik... 82 2e-13 ref|XP_007048797.1| Citrate synthase 2 isoform 1 [Theobroma caca... 82 2e-13 ref|XP_008794152.1| PREDICTED: citrate synthase, glyoxysomal-lik... 81 3e-13 ref|XP_006350017.1| PREDICTED: citrate synthase, glyoxysomal-lik... 80 5e-13 ref|XP_004251813.1| PREDICTED: citrate synthase, glyoxysomal [So... 80 5e-13 ref|XP_002284064.1| PREDICTED: citrate synthase, glyoxysomal [Vi... 80 6e-13 ref|XP_006348933.1| PREDICTED: citrate synthase 3, peroxisomal-l... 80 6e-13 ref|XP_010925583.1| PREDICTED: citrate synthase, glyoxysomal-lik... 80 8e-13 ref|XP_011007678.1| PREDICTED: citrate synthase, glyoxysomal [Po... 79 1e-12 >emb|CDP18733.1| unnamed protein product [Coffea canephora] Length = 517 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/47 (89%), Positives = 47/47 (100%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RPAQVYTGVWLRHYMPLKERM++KEVD+LGQV+VSNATRRRL+GSGA Sbjct: 471 RPAQVYTGVWLRHYMPLKERMIAKEVDRLGQVSVSNATRRRLAGSGA 517 >ref|XP_011082955.1| PREDICTED: citrate synthase, glyoxysomal [Sesamum indicum] Length = 512 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RPAQVYTGVWLRHYMPLKERM++K DKLGQV+VSNATRRRL+GSGA Sbjct: 466 RPAQVYTGVWLRHYMPLKERMITKAEDKLGQVSVSNATRRRLAGSGA 512 >gb|KMT01774.1| hypothetical protein BVRB_9g210550 [Beta vulgaris subsp. vulgaris] Length = 178 Score = 85.9 bits (211), Expect = 1e-14 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RP QVYTG WLRHYMPLKERM+S VDKLGQV+VSNATRRRLSGSGA Sbjct: 132 RPQQVYTGEWLRHYMPLKERMVSSGVDKLGQVSVSNATRRRLSGSGA 178 >ref|XP_010689947.1| PREDICTED: citrate synthase, glyoxysomal [Beta vulgaris subsp. vulgaris] Length = 520 Score = 85.9 bits (211), Expect = 1e-14 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RP QVYTG WLRHYMPLKERM+S VDKLGQV+VSNATRRRLSGSGA Sbjct: 474 RPQQVYTGEWLRHYMPLKERMVSSGVDKLGQVSVSNATRRRLSGSGA 520 >ref|XP_012844318.1| PREDICTED: citrate synthase, glyoxysomal-like [Erythranthe guttatus] gi|604320846|gb|EYU31620.1| hypothetical protein MIMGU_mgv1a004748mg [Erythranthe guttata] Length = 512 Score = 83.6 bits (205), Expect = 5e-14 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RPAQVYTGVWLRHYMPL+ERM ++E DKLGQV+VSNAT+RRL+GSG+ Sbjct: 466 RPAQVYTGVWLRHYMPLRERMDTREEDKLGQVSVSNATKRRLAGSGS 512 >ref|XP_006448012.1| hypothetical protein CICLE_v10014944mg [Citrus clementina] gi|568878544|ref|XP_006492249.1| PREDICTED: citrate synthase, glyoxysomal-like [Citrus sinensis] gi|557550623|gb|ESR61252.1| hypothetical protein CICLE_v10014944mg [Citrus clementina] gi|641839670|gb|KDO58597.1| hypothetical protein CISIN_1g010304mg [Citrus sinensis] Length = 513 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RP QVYTGVW+RHYMPLKERM+ K D+LGQV+VSNATRRRL+GSG Sbjct: 467 RPQQVYTGVWMRHYMPLKERMIEKNADRLGQVSVSNATRRRLAGSG 512 >ref|XP_010915459.1| PREDICTED: citrate synthase, glyoxysomal-like [Elaeis guineensis] Length = 516 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RP QVYTGVWLRHY P++ER++SKE D+LGQVAVSNATRRRL+GSG Sbjct: 470 RPQQVYTGVWLRHYAPVRERLVSKEADRLGQVAVSNATRRRLAGSG 515 >gb|KNA09875.1| hypothetical protein SOVF_149620, partial [Spinacia oleracea] Length = 489 Score = 82.4 bits (202), Expect = 1e-13 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RP QVYTGVWLRHYMPLKER+ S E DKL QV+VSNATRRRLSGSGA Sbjct: 443 RPQQVYTGVWLRHYMPLKERIDSAEEDKLSQVSVSNATRRRLSGSGA 489 >ref|XP_006847773.1| PREDICTED: citrate synthase, glyoxysomal [Amborella trichopoda] gi|769808072|ref|XP_011624600.1| PREDICTED: citrate synthase, glyoxysomal [Amborella trichopoda] gi|769808074|ref|XP_011624601.1| PREDICTED: citrate synthase, glyoxysomal [Amborella trichopoda] gi|769808077|ref|XP_011624602.1| PREDICTED: citrate synthase, glyoxysomal [Amborella trichopoda] gi|548851074|gb|ERN09354.1| hypothetical protein AMTR_s00162p00052420 [Amborella trichopoda] Length = 510 Score = 82.0 bits (201), Expect = 2e-13 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RP QVYTGVWLRHYMPLKER+ + E D+LGQV++SNATRRRL+GSG Sbjct: 464 RPQQVYTGVWLRHYMPLKERLAASEADRLGQVSISNATRRRLAGSG 509 >ref|XP_009596417.1| PREDICTED: citrate synthase, glyoxysomal-like [Nicotiana tomentosiformis] Length = 511 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RPAQVYTGVW+RHYMPLKER E DKLGQV+VSNAT+RRL+GSGA Sbjct: 465 RPAQVYTGVWMRHYMPLKERSPYTETDKLGQVSVSNATKRRLAGSGA 511 >ref|XP_008812537.1| PREDICTED: citrate synthase, glyoxysomal [Phoenix dactylifera] Length = 518 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RP QVYTG WLRHYMP KER LS E DKLGQ+A+SNATRRRLSGSG Sbjct: 472 RPQQVYTGAWLRHYMPPKERTLSAETDKLGQLAISNATRRRLSGSG 517 >ref|XP_009779039.1| PREDICTED: citrate synthase, glyoxysomal-like [Nicotiana sylvestris] gi|594615364|gb|AHM22929.1| citrate synthase [Nicotiana tabacum] Length = 511 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RPAQVYTGVW+RHYMPLKER E DKLGQV+VSNAT+RRL+GSGA Sbjct: 465 RPAQVYTGVWMRHYMPLKERSPYTETDKLGQVSVSNATKRRLAGSGA 511 >ref|XP_007048797.1| Citrate synthase 2 isoform 1 [Theobroma cacao] gi|508701058|gb|EOX92954.1| Citrate synthase 2 isoform 1 [Theobroma cacao] Length = 511 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RP QVYTGVWLRHYMPLKERM + EVDKL QV++SNA+RRRL+GSG Sbjct: 465 RPQQVYTGVWLRHYMPLKERMAATEVDKLSQVSISNASRRRLAGSG 510 >ref|XP_008794152.1| PREDICTED: citrate synthase, glyoxysomal-like [Phoenix dactylifera] Length = 517 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RP QVYTGVWLRHY P++ER++S E DKLGQVAVSNAT+RRL+GSG Sbjct: 471 RPQQVYTGVWLRHYTPVRERLMSNEADKLGQVAVSNATKRRLAGSG 516 >ref|XP_006350017.1| PREDICTED: citrate synthase, glyoxysomal-like [Solanum tuberosum] Length = 514 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RPAQVYTGVW+RHYMPLKER E DKLG V+VSNAT+RRL+GSGA Sbjct: 468 RPAQVYTGVWMRHYMPLKERSPHSEADKLGHVSVSNATKRRLAGSGA 514 >ref|XP_004251813.1| PREDICTED: citrate synthase, glyoxysomal [Solanum lycopersicum] Length = 514 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSGA 226 RPAQVYTGVW+RHYMPLKER E DKLG V+VSNAT+RRL+GSGA Sbjct: 468 RPAQVYTGVWMRHYMPLKERSPHSEADKLGHVSVSNATKRRLAGSGA 514 >ref|XP_002284064.1| PREDICTED: citrate synthase, glyoxysomal [Vitis vinifera] gi|296086334|emb|CBI31775.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 80.1 bits (196), Expect = 6e-13 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RP QVYTG WLRH+MP+KERM+S E D+LGQV++SNATRRRL+GSG Sbjct: 466 RPQQVYTGEWLRHFMPVKERMMSAEADRLGQVSISNATRRRLAGSG 511 >ref|XP_006348933.1| PREDICTED: citrate synthase 3, peroxisomal-like [Solanum tuberosum] Length = 511 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RPAQVYTGVWLRHYMPL++R S E DK GQV+VSNATRRRL+GSG Sbjct: 465 RPAQVYTGVWLRHYMPLQDRSPSAETDKFGQVSVSNATRRRLAGSG 510 >ref|XP_010925583.1| PREDICTED: citrate synthase, glyoxysomal-like [Elaeis guineensis] Length = 518 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RP QVYTGVWLRHY P++ER++S E D+LGQVAVSNATRRRL+G+G Sbjct: 472 RPQQVYTGVWLRHYTPVRERLVSNEADRLGQVAVSNATRRRLAGAG 517 >ref|XP_011007678.1| PREDICTED: citrate synthase, glyoxysomal [Populus euphratica] Length = 508 Score = 79.3 bits (194), Expect = 1e-12 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 366 RPAQVYTGVWLRHYMPLKERMLSKEVDKLGQVAVSNATRRRLSGSG 229 RP QVYTG WLRHYMPLKERM+ + DKLGQV++SNA+RRRL+GSG Sbjct: 462 RPQQVYTGEWLRHYMPLKERMVQTDADKLGQVSISNASRRRLAGSG 507