BLASTX nr result
ID: Perilla23_contig00024691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00024691 (370 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010662916.1| PREDICTED: uncharacterized protein LOC104882... 59 1e-06 gb|KOM40648.1| hypothetical protein LR48_Vigan04g084600 [Vigna a... 58 3e-06 ref|XP_007136494.1| hypothetical protein PHAVU_009G050000g [Phas... 58 3e-06 >ref|XP_010662916.1| PREDICTED: uncharacterized protein LOC104882244 [Vitis vinifera] Length = 33 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 276 MSNIPRSLTDSALTIFKLAISASDPWPFS 190 MSN+PRSLTDS+LT+FKLAISASDPWPFS Sbjct: 1 MSNVPRSLTDSSLTLFKLAISASDPWPFS 29 >gb|KOM40648.1| hypothetical protein LR48_Vigan04g084600 [Vigna angularis] Length = 175 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 276 MSNIPRSLTDSALTIFKLAISASDPWPFSL 187 MSNIPRSLTDS+LT+F LAIS+SDPWPFSL Sbjct: 1 MSNIPRSLTDSSLTLFNLAISSSDPWPFSL 30 >ref|XP_007136494.1| hypothetical protein PHAVU_009G050000g [Phaseolus vulgaris] gi|561009581|gb|ESW08488.1| hypothetical protein PHAVU_009G050000g [Phaseolus vulgaris] gi|947105208|gb|KRH53591.1| hypothetical protein GLYMA_06G134100 [Glycine max] gi|947116043|gb|KRH64345.1| hypothetical protein GLYMA_04G231200 [Glycine max] Length = 33 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 276 MSNIPRSLTDSALTIFKLAISASDPWPFSL 187 MSNIPRSLTDS+LT+F LAIS+SDPWPFSL Sbjct: 1 MSNIPRSLTDSSLTLFNLAISSSDPWPFSL 30