BLASTX nr result
ID: Perilla23_contig00024553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00024553 (379 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085790.1| PREDICTED: paired amphipathic helix protein ... 68 3e-09 ref|XP_012840651.1| PREDICTED: paired amphipathic helix protein ... 60 6e-07 ref|XP_011098545.1| PREDICTED: paired amphipathic helix protein ... 57 7e-06 ref|XP_011098544.1| PREDICTED: paired amphipathic helix protein ... 57 7e-06 >ref|XP_011085790.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X1 [Sesamum indicum] Length = 1346 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 114 MKRMRDDVCLNPQFKRPFGSSSRGETYGLPNPPIGAG 4 MKR+RDDV +NPQFKRPFG SSR E+YGLPNPP+G G Sbjct: 1 MKRLRDDVYVNPQFKRPFGPSSRVESYGLPNPPVGGG 37 >ref|XP_012840651.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 [Erythranthe guttatus] Length = 1349 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -2 Query: 114 MKRMRDDVCLNPQFKRPFGSSSRGETYGLPNPPIGAG 4 MKR+RDD +NPQ KRPFG SSRGE+YGLPN +G G Sbjct: 1 MKRLRDDAYVNPQTKRPFGPSSRGESYGLPNTVVGGG 37 >ref|XP_011098545.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X2 [Sesamum indicum] Length = 1379 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -2 Query: 114 MKRMRDDVCLNPQFKRPFG-SSSRGETYGLPNPPIGAG 4 MKR+RD+V +NPQFKRPFG SSSRGE+YG + P+G G Sbjct: 1 MKRLRDEVYMNPQFKRPFGSSSSRGESYGPSHTPVGGG 38 >ref|XP_011098544.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X1 [Sesamum indicum] Length = 1380 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -2 Query: 114 MKRMRDDVCLNPQFKRPFG-SSSRGETYGLPNPPIGAG 4 MKR+RD+V +NPQFKRPFG SSSRGE+YG + P+G G Sbjct: 1 MKRLRDEVYMNPQFKRPFGSSSSRGESYGPSHTPVGGG 38