BLASTX nr result
ID: Perilla23_contig00024452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00024452 (537 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099626.1| PREDICTED: zinc-finger homeodomain protein 6... 80 8e-13 ref|XP_012834116.1| PREDICTED: zinc-finger homeodomain protein 6... 62 1e-07 >ref|XP_011099626.1| PREDICTED: zinc-finger homeodomain protein 6 [Sesamum indicum] Length = 353 Score = 79.7 bits (195), Expect = 8e-13 Identities = 44/63 (69%), Positives = 49/63 (77%), Gaps = 12/63 (19%) Frame = +3 Query: 210 MERRGQDRDIG------YNPP----ESPVKLPLAPIVSTPPDRR--GILSTRRGSSIFSP 353 MERRGQ+RD+G Y PP ESPVKLPLAPI+STPPDRR ++STRRGSSIFSP Sbjct: 1 MERRGQERDVGIPNSMGYTPPQMIQESPVKLPLAPILSTPPDRRANAMVSTRRGSSIFSP 60 Query: 354 TQT 362 TQT Sbjct: 61 TQT 63 >ref|XP_012834116.1| PREDICTED: zinc-finger homeodomain protein 6 [Erythranthe guttatus] gi|848866910|ref|XP_012834117.1| PREDICTED: zinc-finger homeodomain protein 6 [Erythranthe guttatus] gi|604336386|gb|EYU40171.1| hypothetical protein MIMGU_mgv1a008153mg [Erythranthe guttata] Length = 383 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 5/52 (9%) Frame = +3 Query: 222 GQDRDIGYNPPESPVKLPLAPIVSTPPD--RRG---ILSTRRGSSIFSPTQT 362 G I Y +SPVKLPLAPI+STPPD RRG +LSTRRGSSIFSPT T Sbjct: 19 GMANSISYGGQDSPVKLPLAPILSTPPDHHRRGTISMLSTRRGSSIFSPTLT 70