BLASTX nr result
ID: Perilla23_contig00024441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00024441 (496 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853286.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 gb|EYU23868.1| hypothetical protein MIMGU_mgv1a005901mg [Erythra... 102 1e-19 ref|XP_011074826.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_006351204.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_010324828.1| PREDICTED: pentatricopeptide repeat-containi... 83 7e-14 ref|XP_009783883.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 ref|XP_009620070.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 ref|XP_007227306.1| hypothetical protein PRUPE_ppa016683mg [Prun... 76 1e-11 emb|CDP10963.1| unnamed protein product [Coffea canephora] 75 1e-11 ref|XP_004292714.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_010063939.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_010253174.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_009343975.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_008354409.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_010277208.1| PREDICTED: pentatricopeptide repeat-containi... 74 6e-11 ref|XP_006434253.1| hypothetical protein CICLE_v10003743mg [Citr... 74 6e-11 ref|XP_008219723.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 emb|CBI15606.3| unnamed protein product [Vitis vinifera] 72 2e-10 ref|XP_006472819.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 >ref|XP_012853286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Erythranthe guttatus] Length = 460 Score = 102 bits (254), Expect = 1e-19 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMRLE 316 VEL EGGSIPREYTY +VCNALE GKMDL+DE LC HIESGI NRIRQV KVKPTMR E Sbjct: 399 VELFEGGSIPREYTYEVVCNALEREGKMDLLDENLCRHIESGIENRIRQVKKVKPTMRRE 458 Query: 315 LN 310 ++ Sbjct: 459 MS 460 >gb|EYU23868.1| hypothetical protein MIMGU_mgv1a005901mg [Erythranthe guttata] Length = 465 Score = 102 bits (254), Expect = 1e-19 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMRLE 316 VEL EGGSIPREYTY +VCNALE GKMDL+DE LC HIESGI NRIRQV KVKPTMR E Sbjct: 404 VELFEGGSIPREYTYEVVCNALEREGKMDLLDENLCRHIESGIENRIRQVKKVKPTMRRE 463 Query: 315 LN 310 ++ Sbjct: 464 MS 465 >ref|XP_011074826.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Sesamum indicum] Length = 449 Score = 95.1 bits (235), Expect = 2e-17 Identities = 45/60 (75%), Positives = 52/60 (86%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMRLE 316 VELV GGS+PREYTY+LVCNAL+SAGKMDL++E LC IE I +RI QVMKVKPTMRL+ Sbjct: 384 VELVVGGSVPREYTYKLVCNALQSAGKMDLLNENLCRDIEGAIGSRISQVMKVKPTMRLD 443 >ref|XP_006351204.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Solanum tuberosum] Length = 440 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/58 (68%), Positives = 49/58 (84%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMR 322 VEL E GSIPREYTY+LV +ALES+GK+DL+DE LC+ +E GI RIRQVMKVKP ++ Sbjct: 378 VELAEQGSIPREYTYKLVRDALESSGKIDLLDEELCTRLEDGIKGRIRQVMKVKPLLQ 435 >ref|XP_010324828.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 isoform X1 [Solanum lycopersicum] Length = 426 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/58 (67%), Positives = 49/58 (84%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMR 322 VE+ E GSIPREYTY+LV +ALES+GK+DL+DE LC+ +E GI RIRQVMKVKP ++ Sbjct: 362 VEVAEQGSIPREYTYKLVRDALESSGKIDLLDEELCTRLEDGIKGRIRQVMKVKPLLQ 419 >ref|XP_009783883.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Nicotiana sylvestris] Length = 447 Score = 80.5 bits (197), Expect = 5e-13 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMRLE 316 VEL E GSIPREYTY+LV +ALESAGK+DL+D C +E GI RIRQVMK+KP ++ E Sbjct: 383 VELAEHGSIPREYTYKLVRDALESAGKIDLLDAEFCRRLEDGIKGRIRQVMKMKPLLQHE 442 >ref|XP_009620070.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Nicotiana tomentosiformis] Length = 447 Score = 80.5 bits (197), Expect = 5e-13 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMRLE 316 VEL E GSIPREYTY+LV +ALESAGK+DL+D C +E GI RIRQVMK+KP ++ E Sbjct: 385 VELAEQGSIPREYTYKLVRDALESAGKIDLLDAEFCRRLEDGIKGRIRQVMKMKPLLQHE 444 >ref|XP_007227306.1| hypothetical protein PRUPE_ppa016683mg [Prunus persica] gi|462424242|gb|EMJ28505.1| hypothetical protein PRUPE_ppa016683mg [Prunus persica] Length = 449 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/56 (62%), Positives = 46/56 (82%) Frame = -2 Query: 492 ELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTM 325 EL++GGSIPREYTY+LVC+AL SAG+++L+D L I+ GI +R RQ+MKVKP M Sbjct: 383 ELIDGGSIPREYTYKLVCDALNSAGELNLLDNDLHRRIKYGIESRYRQIMKVKPIM 438 >emb|CDP10963.1| unnamed protein product [Coffea canephora] Length = 315 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/62 (58%), Positives = 48/62 (77%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMRLE 316 VELVE GSIPREYTY LV +AL+S+ +++++D + C IE GI NRI QVMK+KP ++ E Sbjct: 242 VELVEQGSIPREYTYTLVQDALKSSSQINVLDRKYCKKIEEGIQNRITQVMKMKPILKRE 301 Query: 315 LN 310 N Sbjct: 302 TN 303 >ref|XP_004292714.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Fragaria vesca subsp. vesca] Length = 444 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/57 (61%), Positives = 45/57 (78%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTM 325 VELV+GGSIPREYTY LVCNAL SAG+++++D+ L IE G+ R + +MKVKP M Sbjct: 377 VELVDGGSIPREYTYNLVCNALSSAGEVNVLDDGLRERIEDGMQRRYKHMMKVKPIM 433 >ref|XP_010063939.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Eucalyptus grandis] Length = 442 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/62 (53%), Positives = 48/62 (77%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMRLE 316 +ELV+GGS+PREYTY+LVC+A+ S+G L+D++L I+ I R+RQVMKVKP + + Sbjct: 381 IELVDGGSVPREYTYKLVCDAINSSGASGLIDDKLHRKIQDDIEKRLRQVMKVKPLVTCQ 440 Query: 315 LN 310 L+ Sbjct: 441 LS 442 >ref|XP_010253174.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Nelumbo nucifera] Length = 492 Score = 74.3 bits (181), Expect = 3e-11 Identities = 39/58 (67%), Positives = 45/58 (77%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMR 322 VELVEGGSIPREYTYRLVC+AL SAG DE + IE+GI NR +QVM+VKP M+ Sbjct: 424 VELVEGGSIPREYTYRLVCDALSSAGDAGFSDE-IQRWIENGIKNRYKQVMQVKPIMK 480 >ref|XP_009343975.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Pyrus x bretschneideri] Length = 444 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/57 (59%), Positives = 46/57 (80%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTM 325 VE+++GGSIPREYTY+LVC AL SAG+++L+D+ + I+ GI +R RQ MKVKP M Sbjct: 377 VEMIDGGSIPREYTYKLVCYALNSAGEVNLLDDDVRKTIKDGIVSRYRQTMKVKPMM 433 >ref|XP_008354409.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Malus domestica] Length = 452 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/57 (59%), Positives = 46/57 (80%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTM 325 VE+++GGSIPREYTY+LVC AL SAG+++L+D+ + I+ GI +R RQ MKVKP M Sbjct: 385 VEMIDGGSIPREYTYKLVCYALNSAGEVNLLDDDVRKTIKDGIVSRYRQTMKVKPMM 441 >ref|XP_010277208.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Nelumbo nucifera] Length = 493 Score = 73.6 bits (179), Expect = 6e-11 Identities = 38/58 (65%), Positives = 45/58 (77%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMR 322 VELVEGGSIPREYTYRLVC+AL SAG DE + IE+GI NR +Q+M+VKP M+ Sbjct: 425 VELVEGGSIPREYTYRLVCDALSSAGDAGFSDE-IRRWIENGINNRYKQIMQVKPIMK 481 >ref|XP_006434253.1| hypothetical protein CICLE_v10003743mg [Citrus clementina] gi|557536375|gb|ESR47493.1| hypothetical protein CICLE_v10003743mg [Citrus clementina] Length = 451 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = -2 Query: 492 ELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMR 322 ELV+GGS+PREYTY+LVC+AL +A + L D+ L I GI NR RQVMKVKP M+ Sbjct: 383 ELVDGGSVPREYTYKLVCDALNAAEEPSLPDDGLRKRIRDGIENRFRQVMKVKPIMK 439 >ref|XP_008219723.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Prunus mume] Length = 449 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -2 Query: 492 ELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTM 325 EL++GGSIPREYTY+LVC+AL SAG+ + +D L I+ GI +R RQ+MKVKP M Sbjct: 383 ELIDGGSIPREYTYKLVCDALNSAGEFNSLDNDLHRRIKYGIESRHRQIMKVKPIM 438 >ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Vitis vinifera] gi|731426722|ref|XP_010663713.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Vitis vinifera] gi|731426725|ref|XP_010663714.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Vitis vinifera] Length = 432 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/57 (56%), Positives = 46/57 (80%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTM 325 +ELV+GGS+PREYTY++VC++L SAG+ +++ + L IE+GI NR +QVMKVK M Sbjct: 370 IELVDGGSVPREYTYKVVCDSLRSAGEANMLGDELRGRIENGIENRYKQVMKVKLIM 426 >emb|CBI15606.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/57 (56%), Positives = 46/57 (80%) Frame = -2 Query: 495 VELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTM 325 +ELV+GGS+PREYTY++VC++L SAG+ +++ + L IE+GI NR +QVMKVK M Sbjct: 319 IELVDGGSVPREYTYKVVCDSLRSAGEANMLGDELRGRIENGIENRYKQVMKVKLIM 375 >ref|XP_006472819.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like isoform X1 [Citrus sinensis] gi|568837618|ref|XP_006472820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like isoform X2 [Citrus sinensis] gi|641861844|gb|KDO80531.1| hypothetical protein CISIN_1g013010mg [Citrus sinensis] Length = 451 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -2 Query: 492 ELVEGGSIPREYTYRLVCNALESAGKMDLVDERLCSHIESGIANRIRQVMKVKPTMR 322 ELV+GGS+PREYTY+LVC+AL +A + L+D+ L I GI R RQVMKVKP M+ Sbjct: 383 ELVDGGSVPREYTYKLVCDALNAAEEPSLLDDGLRKRIRDGIEYRFRQVMKVKPIMK 439