BLASTX nr result
ID: Perilla23_contig00024046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00024046 (583 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846209.1| PREDICTED: uncharacterized protein LOC105966... 59 2e-06 gb|EYU30063.1| hypothetical protein MIMGU_mgv1a002891mg [Erythra... 59 2e-06 >ref|XP_012846209.1| PREDICTED: uncharacterized protein LOC105966189 [Erythranthe guttatus] Length = 642 Score = 58.9 bits (141), Expect = 2e-06 Identities = 33/66 (50%), Positives = 42/66 (63%), Gaps = 2/66 (3%) Frame = -3 Query: 578 QPELSTPERPPGFESVKVENLPELGYTESEQASAGEVI--GSTLMLRQLKCRSRRYSEPQ 405 +P S+P++PPGFES+ VENLP G E AS+ E I GST RQL+ S SEP+ Sbjct: 456 KPNFSSPKKPPGFESIGVENLPHSGSRNMELASSAEEILSGSTRTRRQLRRWSMSSSEPK 515 Query: 404 AVTVTS 387 VT+ S Sbjct: 516 PVTMAS 521 >gb|EYU30063.1| hypothetical protein MIMGU_mgv1a002891mg [Erythranthe guttata] Length = 628 Score = 58.9 bits (141), Expect = 2e-06 Identities = 33/66 (50%), Positives = 42/66 (63%), Gaps = 2/66 (3%) Frame = -3 Query: 578 QPELSTPERPPGFESVKVENLPELGYTESEQASAGEVI--GSTLMLRQLKCRSRRYSEPQ 405 +P S+P++PPGFES+ VENLP G E AS+ E I GST RQL+ S SEP+ Sbjct: 442 KPNFSSPKKPPGFESIGVENLPHSGSRNMELASSAEEILSGSTRTRRQLRRWSMSSSEPK 501 Query: 404 AVTVTS 387 VT+ S Sbjct: 502 PVTMAS 507