BLASTX nr result
ID: Perilla23_contig00024016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00024016 (419 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038295.1| F-box family protein, putative [Theobroma ca... 46 3e-07 >ref|XP_007038295.1| F-box family protein, putative [Theobroma cacao] gi|508775540|gb|EOY22796.1| F-box family protein, putative [Theobroma cacao] Length = 407 Score = 45.8 bits (107), Expect(2) = 3e-07 Identities = 20/46 (43%), Positives = 32/46 (69%) Frame = +2 Query: 23 STQQLWELSLAFAPSKSPHYKIVCVKATRNPLSDHERHCWVEVYDS 160 S++ + +SLAF PSKSPHYK++C++ + L DH + +E+Y S Sbjct: 163 SSRNTFGVSLAFDPSKSPHYKVICIRNCDSDLPDHYQ---IEIYSS 205 Score = 35.0 bits (79), Expect(2) = 3e-07 Identities = 28/93 (30%), Positives = 37/93 (39%), Gaps = 23/93 (24%) Frame = +1 Query: 181 FTAPIAANFSSGVH--------SCWSS---------------MA*EGGGAAVHRKLQEPN 291 F API F +GV S W MA G ++R + Sbjct: 217 FAAPINVQFKNGVFWNGALHWLSDWGDSLCFDVEEERIRDLPMAPVVGDVRLYRYFGQSG 276 Query: 292 GYLYHFIIVSHLGDKSIAVYELQKDYSQWFLKY 390 G+L H I V VYE+++DYS WF+KY Sbjct: 277 GHL-HLIEVYGSDTLQFDVYEMERDYSGWFVKY 308