BLASTX nr result
ID: Perilla23_contig00023924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00023924 (667 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069926.1| PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE... 78 4e-12 >ref|XP_011069926.1| PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE 1 [Sesamum indicum] Length = 446 Score = 78.2 bits (191), Expect = 4e-12 Identities = 33/59 (55%), Positives = 46/59 (77%) Frame = -1 Query: 667 ETFAHISDLDEKALVGSDSEDDHTEVHFGKDEAMHCLEDGSDTDGSEMDVKGVCREYND 491 E+F +SD+++K L+GSDSEDDH ++ G+DE MH LE S TDGSEM+++ VCR YN+ Sbjct: 388 ESFDDLSDMEDKTLLGSDSEDDHVQLELGQDETMHSLESTSTTDGSEMEIEEVCRAYNN 446