BLASTX nr result
ID: Perilla23_contig00023710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00023710 (416 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086463.1| PREDICTED: two-component response regulator ... 59 2e-06 ref|XP_012847768.1| PREDICTED: two-component response regulator ... 57 4e-06 >ref|XP_011086463.1| PREDICTED: two-component response regulator ARR17 [Sesamum indicum] Length = 240 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 7/45 (15%) Frame = -3 Query: 414 AEDFIVKPVKLSDVKRLKSCMFGEGQR-------LNKRKLHEDNN 301 AEDFIVKPVKLSDVKRLKSCMFGEG+ NKRKL ++++ Sbjct: 140 AEDFIVKPVKLSDVKRLKSCMFGEGRMQRQDGGGFNKRKLQDNSD 184 >ref|XP_012847768.1| PREDICTED: two-component response regulator ARR5 [Erythranthe guttatus] gi|604316462|gb|EYU28654.1| hypothetical protein MIMGU_mgv1a012764mg [Erythranthe guttata] Length = 241 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 6/43 (13%) Frame = -3 Query: 414 AEDFIVKPVKLSDVKRLKSCMFGEG------QRLNKRKLHEDN 304 AEDFIVKPVKL+DVKRLK CMFGEG + NKRKL +D+ Sbjct: 142 AEDFIVKPVKLADVKRLKRCMFGEGRIPKQERAFNKRKLQQDS 184