BLASTX nr result
ID: Perilla23_contig00023558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00023558 (358 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013464414.1| disease resistance protein (CC-NBS-LRR class... 57 7e-06 >ref|XP_013464414.1| disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] gi|657398932|gb|KEH38449.1| disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] Length = 1585 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/63 (39%), Positives = 41/63 (65%) Frame = -1 Query: 355 FPNLKRLYLWNLKKLKSFCEWRCTLQLPKLEHLDIIDCDVMDEFTLGALNTPNLKTIYID 176 F LK L L NL +L+SFC+ + +L+ P L+ L ++DC +M+ F+ G LN P L+ +++ Sbjct: 1499 FMKLKYLKLINLPRLRSFCKGKHSLKFPLLKKLFVVDCPMMETFSHGVLNAPKLRAVHVK 1558 Query: 175 SHD 167 D Sbjct: 1559 EGD 1561