BLASTX nr result
ID: Perilla23_contig00022875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00022875 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073190.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 gb|EYU21817.1| hypothetical protein MIMGU_mgv1a0008302mg, partia... 58 2e-06 >ref|XP_011073190.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Sesamum indicum] Length = 1035 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = -1 Query: 424 EELHKVIDAMVSYGWVPPSMSLIDLVNQYRREDIQ--SDPSVQATPEVACQI 275 EEL KV D MVS+GWVP S+SL DL+ QY+ D++ SD S++A EV CQ+ Sbjct: 984 EELDKVFDVMVSFGWVPSSLSLNDLIIQYQPGDLEIGSDQSMRAVSEVVCQV 1035 >gb|EYU21817.1| hypothetical protein MIMGU_mgv1a0008302mg, partial [Erythranthe guttata] Length = 142 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/52 (53%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = -1 Query: 424 EELHKVIDAMVSYGWVPPSMSLIDLVNQYRREDIQSDPSVQ--ATPEVACQI 275 +E+ KV+D MV +GWVPPSMSL DL+ QY+R ++ S V A E+ACQI Sbjct: 91 KEVDKVLDVMVRFGWVPPSMSLNDLIGQYQRGNLDSKNEVSGLAANEIACQI 142