BLASTX nr result
ID: Perilla23_contig00022335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00022335 (376 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102115.1| PREDICTED: tetratricopeptide repeat protein ... 97 5e-18 ref|XP_012843272.1| PREDICTED: tetratricopeptide repeat protein ... 88 2e-15 >ref|XP_011102115.1| PREDICTED: tetratricopeptide repeat protein 33 [Sesamum indicum] Length = 214 Score = 97.1 bits (240), Expect = 5e-18 Identities = 50/81 (61%), Positives = 58/81 (71%) Frame = -2 Query: 375 SVNDSKNKTRKRPISLNPNLPFEDVXXXXXXXXXAEPLNEGKFLGNDGLSDKKTTISDEE 196 + DSKNKTRKRPIS NPNLPFED+ A + EG+ GND +S K TT SDEE Sbjct: 8 NAGDSKNKTRKRPISFNPNLPFEDLNSSSDTNTTAAKMKEGESRGNDDVSKKGTTSSDEE 67 Query: 195 AEERRNLAGEFEAQGNKLAEE 133 E+RRNLA +FEAQGN+LAEE Sbjct: 68 DEKRRNLAQDFEAQGNRLAEE 88 >ref|XP_012843272.1| PREDICTED: tetratricopeptide repeat protein 33 [Erythranthe guttatus] gi|604322072|gb|EYU32490.1| hypothetical protein MIMGU_mgv1a013706mg [Erythranthe guttata] Length = 212 Score = 88.2 bits (217), Expect = 2e-15 Identities = 48/80 (60%), Positives = 59/80 (73%), Gaps = 1/80 (1%) Frame = -2 Query: 369 NDSK-NKTRKRPISLNPNLPFEDVXXXXXXXXXAEPLNEGKFLGNDGLSDKKTTISDEEA 193 NDSK + +RKRPISLNPNLPFEDV EP EG+ +GND +S+ KT+ SDEE Sbjct: 10 NDSKKSNSRKRPISLNPNLPFEDVNSTSDSA---EPPREGELIGNDDVSNNKTSRSDEED 66 Query: 192 EERRNLAGEFEAQGNKLAEE 133 ++R+NLA FE+QGNKLAEE Sbjct: 67 DKRKNLALYFESQGNKLAEE 86