BLASTX nr result
ID: Perilla23_contig00022170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00022170 (358 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077982.1| PREDICTED: receptor-like serine/threonine-pr... 62 2e-07 >ref|XP_011077982.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2 [Sesamum indicum] Length = 1068 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = +1 Query: 172 MELVMLQDLGLVLQVWLFACLLVIQGSSVASFEEGKPGYVYVANVLIGEAPTPVPQPIG 348 ME++MLQ LGLVL V C L++QGS+V G PG++Y +V I APTPVPQP G Sbjct: 1 MEVMMLQVLGLVLNVCAVVCSLLVQGSAVPPTGVGIPGHMYNFDVFITAAPTPVPQPNG 59