BLASTX nr result
ID: Perilla23_contig00022132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00022132 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079111.1| PREDICTED: cationic amino acid transporter 3... 67 7e-09 ref|XP_009589805.1| PREDICTED: cationic amino acid transporter 2... 60 6e-07 ref|XP_009589804.1| PREDICTED: cationic amino acid transporter 2... 60 6e-07 ref|XP_009794642.1| PREDICTED: cationic amino acid transporter 2... 60 8e-07 ref|XP_012845846.1| PREDICTED: cationic amino acid transporter 2... 59 1e-06 gb|EYU30342.1| hypothetical protein MIMGU_mgv1a0026502mg, partia... 59 1e-06 ref|XP_011069953.1| PREDICTED: cationic amino acid transporter 2... 58 2e-06 ref|XP_011001711.1| PREDICTED: cationic amino acid transporter 4... 58 2e-06 ref|XP_012857485.1| PREDICTED: cationic amino acid transporter 2... 58 2e-06 ref|XP_009772147.1| PREDICTED: cationic amino acid transporter 2... 57 5e-06 ref|XP_009772146.1| PREDICTED: cationic amino acid transporter 2... 57 5e-06 ref|XP_007029985.1| Cationic amino acid transporter 2 isoform 1 ... 57 5e-06 ref|XP_002325437.2| hypothetical protein POPTR_0019s05610g [Popu... 57 7e-06 ref|XP_009604785.1| PREDICTED: cationic amino acid transporter 2... 56 9e-06 ref|XP_009604778.1| PREDICTED: cationic amino acid transporter 2... 56 9e-06 >ref|XP_011079111.1| PREDICTED: cationic amino acid transporter 3, mitochondrial-like [Sesamum indicum] gi|747065000|ref|XP_011079112.1| PREDICTED: cationic amino acid transporter 3, mitochondrial-like [Sesamum indicum] Length = 646 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSS 197 IWL LALL Y+ YGR SPL+HAVYVPAAHVDEIY SS+ Sbjct: 604 IWLGLALLAYVFYGRMHSPLQHAVYVPAAHVDEIYRTSSN 643 >ref|XP_009589805.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X2 [Nicotiana tomentosiformis] Length = 642 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSSVA 191 +WLAL + VY YGRT S L++AVYVPA HVDEIY+ S+S+A Sbjct: 600 VWLALGVCVYAFYGRTHSSLQNAVYVPATHVDEIYQSSASLA 641 >ref|XP_009589804.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X1 [Nicotiana tomentosiformis] Length = 644 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSSVA 191 +WLAL + VY YGRT S L++AVYVPA HVDEIY+ S+S+A Sbjct: 602 VWLALGVCVYAFYGRTHSSLQNAVYVPATHVDEIYQSSASLA 643 >ref|XP_009794642.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Nicotiana sylvestris] Length = 641 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSSVA 191 +WLAL + VY YGRT S L++AVYVPA HVDEIY+ S+S+A Sbjct: 600 LWLALGVCVYAFYGRTHSSLQNAVYVPATHVDEIYQSSASLA 641 >ref|XP_012845846.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Erythranthe guttatus] Length = 650 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSSVAL 188 IWL + +LVYI YGR S L+ AVYVPAAHVDEIYE S + L Sbjct: 608 IWLVVGVLVYIFYGRKNSSLRDAVYVPAAHVDEIYESHSDLVL 650 >gb|EYU30342.1| hypothetical protein MIMGU_mgv1a0026502mg, partial [Erythranthe guttata] Length = 321 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSSVAL 188 IWL + +LVYI YGR S L+ AVYVPAAHVDEIYE S + L Sbjct: 279 IWLVVGVLVYIFYGRKNSSLRDAVYVPAAHVDEIYESHSDLVL 321 >ref|XP_011069953.1| PREDICTED: cationic amino acid transporter 2, vacuolar isoform X1 [Sesamum indicum] Length = 653 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSS 197 IWL + +VYI YGR S L+ AVYVPAAHVDEIYE SS+ Sbjct: 611 IWLGIGAIVYIFYGRRHSSLQDAVYVPAAHVDEIYESSSN 650 >ref|XP_011001711.1| PREDICTED: cationic amino acid transporter 4, vacuolar isoform X1 [Populus euphratica] Length = 643 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSSV 194 IWL + LVY+ YGRT S LK+AVYVP AH DEIY SS + Sbjct: 601 IWLLIGALVYLFYGRTHSSLKNAVYVPTAHADEIYRTSSDL 641 >ref|XP_012857485.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Erythranthe guttatus] gi|604301167|gb|EYU20887.1| hypothetical protein MIMGU_mgv1a002919mg [Erythranthe guttata] Length = 625 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSS 197 +WL +AL YI YGR S L++AVYVPA+HVDEIYE SS+ Sbjct: 583 VWLVVALFAYIFYGRKHSLLENAVYVPASHVDEIYETSSN 622 >ref|XP_009772147.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X2 [Nicotiana sylvestris] Length = 646 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSS 197 IWL L +Y YGRT S LK+AVYVPA HVDEIY+ S++ Sbjct: 603 IWLLLGACIYALYGRTHSSLKNAVYVPATHVDEIYQTSAN 642 >ref|XP_009772146.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X1 [Nicotiana sylvestris] Length = 649 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSS 197 IWL L +Y YGRT S LK+AVYVPA HVDEIY+ S++ Sbjct: 606 IWLLLGACIYALYGRTHSSLKNAVYVPATHVDEIYQTSAN 645 >ref|XP_007029985.1| Cationic amino acid transporter 2 isoform 1 [Theobroma cacao] gi|590640566|ref|XP_007029987.1| Cationic amino acid transporter 2 isoform 1 [Theobroma cacao] gi|508718590|gb|EOY10487.1| Cationic amino acid transporter 2 isoform 1 [Theobroma cacao] gi|508718592|gb|EOY10489.1| Cationic amino acid transporter 2 isoform 1 [Theobroma cacao] Length = 640 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSSVA 191 +WL L LVY+ YGRT S L AVYVPAAH DEIY S+A Sbjct: 599 VWLVLGFLVYVFYGRTHSSLLDAVYVPAAHADEIYRSGDSLA 640 >ref|XP_002325437.2| hypothetical protein POPTR_0019s05610g [Populus trichocarpa] gi|550316879|gb|EEE99818.2| hypothetical protein POPTR_0019s05610g [Populus trichocarpa] Length = 643 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSSV 194 IWL + LVY+ YGRT S LK+AVYVP AH +EIY SS + Sbjct: 601 IWLLIGALVYLFYGRTHSSLKNAVYVPTAHAEEIYRTSSDL 641 >ref|XP_009604785.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X2 [Nicotiana tomentosiformis] Length = 646 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSS 197 IWL + +Y YGRT S LK+AVYVPA HVDEIY+ S++ Sbjct: 603 IWLLIGACIYALYGRTHSSLKNAVYVPATHVDEIYQTSAN 642 >ref|XP_009604778.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X1 [Nicotiana tomentosiformis] Length = 649 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -3 Query: 316 IWLALALLVYICYGRTRSPLKHAVYVPAAHVDEIYEVSSS 197 IWL + +Y YGRT S LK+AVYVPA HVDEIY+ S++ Sbjct: 606 IWLLIGACIYALYGRTHSSLKNAVYVPATHVDEIYQTSAN 645