BLASTX nr result
ID: Perilla23_contig00021867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00021867 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847365.1| PREDICTED: ferredoxin-thioredoxin reductase,... 107 3e-21 ref|XP_011087933.1| PREDICTED: ferredoxin-thioredoxin reductase,... 104 2e-20 emb|CDP07798.1| unnamed protein product [Coffea canephora] 95 2e-17 gb|EPS66315.1| hypothetical protein M569_08467, partial [Genlise... 95 2e-17 ref|XP_006345426.1| PREDICTED: ferredoxin-thioredoxin reductase,... 95 2e-17 ref|XP_004229646.1| PREDICTED: ferredoxin-thioredoxin reductase,... 94 5e-17 ref|XP_009630916.1| PREDICTED: ferredoxin-thioredoxin reductase,... 92 1e-16 emb|CAC39619.1| subunit A of ferredoxin-thioredoxin-reductase [S... 91 3e-16 ref|XP_009776324.1| PREDICTED: ferredoxin-thioredoxin reductase,... 89 2e-15 ref|XP_004489188.1| PREDICTED: ferredoxin-thioredoxin reductase,... 87 4e-15 ref|XP_002513160.1| lipoic acid synthetase, putative [Ricinus co... 86 8e-15 ref|XP_010067051.1| PREDICTED: ferredoxin-thioredoxin reductase,... 86 1e-14 ref|XP_007043150.1| Ferredoxin/thioredoxin reductase subunit A 2... 86 1e-14 ref|NP_001295702.1| ferredoxin-thioredoxin reductase, variable c... 86 1e-14 ref|XP_010547704.1| PREDICTED: ferredoxin-thioredoxin reductase,... 84 3e-14 ref|XP_010521756.1| PREDICTED: ferredoxin-thioredoxin reductase,... 84 3e-14 ref|XP_002271306.1| PREDICTED: ferredoxin-thioredoxin reductase,... 83 9e-14 ref|XP_006468671.1| PREDICTED: ferredoxin-thioredoxin reductase,... 82 2e-13 ref|XP_013450699.1| ferredoxin-thioredoxin reductase, variable c... 82 2e-13 ref|XP_006448508.1| hypothetical protein CICLE_v10017019mg [Citr... 82 2e-13 >ref|XP_012847365.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Erythranthe guttatus] gi|604316951|gb|EYU29040.1| hypothetical protein MIMGU_mgv1a015025mg [Erythranthe guttata] Length = 170 Score = 107 bits (267), Expect = 3e-21 Identities = 48/61 (78%), Positives = 57/61 (93%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 L VYH+PKLPE+DLTG+VG+LKQYV V KGK+ISANLPYK+EFVA+++ GRDGKPVKFSA Sbjct: 100 LVVYHIPKLPELDLTGKVGVLKQYVGVHKGKKISANLPYKIEFVADDLPGRDGKPVKFSA 159 Query: 197 H 195 H Sbjct: 160 H 160 >ref|XP_011087933.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Sesamum indicum] Length = 168 Score = 104 bits (260), Expect = 2e-20 Identities = 47/61 (77%), Positives = 56/61 (91%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 +KVYHVPK+PE +LTG++G+LKQYV V KGK+ISANLPYKVEFVA+EV GRDG PVKF+A Sbjct: 98 VKVYHVPKVPEFELTGKIGVLKQYVGVHKGKKISANLPYKVEFVADEVLGRDGNPVKFTA 157 Query: 197 H 195 H Sbjct: 158 H 158 >emb|CDP07798.1| unnamed protein product [Coffea canephora] Length = 178 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 +KVYHVPK+PE DL GR+G LKQYVAV KGK+ISANLPYKVEFV E V G+ G PVKF A Sbjct: 109 IKVYHVPKVPETDLNGRIGFLKQYVAVHKGKKISANLPYKVEFVEEHVEGKKG-PVKFFA 167 Query: 197 H 195 H Sbjct: 168 H 168 >gb|EPS66315.1| hypothetical protein M569_08467, partial [Genlisea aurea] Length = 77 Score = 95.1 bits (235), Expect = 2e-17 Identities = 43/61 (70%), Positives = 54/61 (88%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 +KVYHVPK+ E+DL G+VG+LKQYV +KGKRISANLPY++EF A++V GR+GKPVKF A Sbjct: 10 VKVYHVPKVGEMDLKGKVGVLKQYVGSYKGKRISANLPYQIEFSADDVVGRNGKPVKFVA 69 Query: 197 H 195 H Sbjct: 70 H 70 >ref|XP_006345426.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Solanum tuberosum] Length = 171 Score = 94.7 bits (234), Expect = 2e-17 Identities = 45/61 (73%), Positives = 53/61 (86%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVPK+PE+DL GR+G +KQYVAV KGK+ISANLPYKVEFV +++ GR PVKFSA Sbjct: 102 LKVYHVPKVPELDLDGRIGTVKQYVAVHKGKQISANLPYKVEFVVDDLEGR-STPVKFSA 160 Query: 197 H 195 H Sbjct: 161 H 161 >ref|XP_004229646.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Solanum lycopersicum] Length = 171 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVPK+PE+DL GR G +KQYVAV KGK+ISANLPYKVEFV +++ GR PVKFSA Sbjct: 102 LKVYHVPKVPELDLDGRTGTVKQYVAVHKGKQISANLPYKVEFVVDDLEGR-STPVKFSA 160 Query: 197 H 195 H Sbjct: 161 H 161 >ref|XP_009630916.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nicotiana tomentosiformis] Length = 164 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/61 (72%), Positives = 50/61 (81%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVPK+PE+DL R+G LKQYV KGK+ISANLPYKVEFV + + GRDG PVKF A Sbjct: 95 LKVYHVPKVPELDLVNRIGTLKQYVGFHKGKQISANLPYKVEFVVDNLEGRDG-PVKFLA 153 Query: 197 H 195 H Sbjct: 154 H 154 >emb|CAC39619.1| subunit A of ferredoxin-thioredoxin-reductase [Solanum tuberosum] Length = 171 Score = 91.3 bits (225), Expect = 3e-16 Identities = 43/61 (70%), Positives = 52/61 (85%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYH PK+PE+DL GR+G +KQYVAV KGK+ISANLPYKV+FV +++ GR PVKFSA Sbjct: 102 LKVYHEPKVPELDLDGRIGTVKQYVAVHKGKQISANLPYKVQFVVDDLEGR-STPVKFSA 160 Query: 197 H 195 H Sbjct: 161 H 161 >ref|XP_009776324.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nicotiana sylvestris] Length = 164 Score = 88.6 bits (218), Expect = 2e-15 Identities = 43/61 (70%), Positives = 48/61 (78%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVPK+PE+DL R+G LKQYV KGK+ISANLPYKVEFV + GRDG VKF A Sbjct: 95 LKVYHVPKVPELDLVNRIGTLKQYVGFHKGKQISANLPYKVEFVVANLEGRDGS-VKFLA 153 Query: 197 H 195 H Sbjct: 154 H 154 >ref|XP_004489188.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Cicer arietinum] Length = 129 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/61 (68%), Positives = 52/61 (85%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVPK+PEIDL G G +KQ VA++KGKRISANLPYKVEF+++++ G G P+KFSA Sbjct: 61 LKVYHVPKVPEIDLAGMEGNIKQNVALWKGKRISANLPYKVEFISKDIQGPRG-PLKFSA 119 Query: 197 H 195 H Sbjct: 120 H 120 >ref|XP_002513160.1| lipoic acid synthetase, putative [Ricinus communis] gi|223548171|gb|EEF49663.1| lipoic acid synthetase, putative [Ricinus communis] Length = 184 Score = 86.3 bits (212), Expect = 8e-15 Identities = 43/61 (70%), Positives = 52/61 (85%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVP++PE+DLTG+ G LKQYVA++KGKRISANLPYKVEF+ ++ GR PVKF A Sbjct: 117 LKVYHVPRVPEVDLTGKEGHLKQYVALWKGKRISANLPYKVEFLV-DIEGRG--PVKFFA 173 Query: 197 H 195 H Sbjct: 174 H 174 >ref|XP_010067051.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Eucalyptus grandis] gi|629099351|gb|KCW65116.1| hypothetical protein EUGRSUZ_G02623 [Eucalyptus grandis] Length = 188 Score = 85.9 bits (211), Expect = 1e-14 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVP++PE+DLTG G LKQYVA FKGKRISANLP+KV+FV +E+ GR PVKF A Sbjct: 122 LKVYHVPRVPEVDLTGMEGELKQYVAEFKGKRISANLPFKVQFV-KEIEGRG--PVKFFA 178 Query: 197 H 195 H Sbjct: 179 H 179 >ref|XP_007043150.1| Ferredoxin/thioredoxin reductase subunit A 2 [Theobroma cacao] gi|508707085|gb|EOX98981.1| Ferredoxin/thioredoxin reductase subunit A 2 [Theobroma cacao] Length = 168 Score = 85.5 bits (210), Expect = 1e-14 Identities = 43/61 (70%), Positives = 52/61 (85%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVP++ E+DLTG G++KQYVA++KGKRISANLPYKVEFV +E+ GR PVKF A Sbjct: 101 LKVYHVPRVQEVDLTGMEGVIKQYVALWKGKRISANLPYKVEFV-KEIEGRG--PVKFFA 157 Query: 197 H 195 H Sbjct: 158 H 158 >ref|NP_001295702.1| ferredoxin-thioredoxin reductase, variable chain, chloroplastic [Jatropha curcas] gi|373943293|gb|AEY80143.1| lipoic acid synthase [Jatropha curcas] gi|643733612|gb|KDP40455.1| hypothetical protein JCGZ_24454 [Jatropha curcas] Length = 201 Score = 85.5 bits (210), Expect = 1e-14 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVP++PE+DLTG+ G LKQYVA++KGKRISANLPYKVEF ++ GR PVKF A Sbjct: 134 LKVYHVPRVPEVDLTGKEGNLKQYVALWKGKRISANLPYKVEFTM-DIEGRG--PVKFFA 190 Query: 197 H 195 H Sbjct: 191 H 191 >ref|XP_010547704.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain, chloroplastic [Tarenaya hassleriana] Length = 184 Score = 84.3 bits (207), Expect = 3e-14 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHV ++PE+DLTG G++K YVAV+KGKRISANLPYKVEFV +E+ GR PVKF A Sbjct: 116 LKVYHVVRVPEVDLTGMEGVIKNYVAVWKGKRISANLPYKVEFV-KEIEGRG--PVKFVA 172 Query: 197 H 195 H Sbjct: 173 H 173 >ref|XP_010521756.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Tarenaya hassleriana] Length = 170 Score = 84.3 bits (207), Expect = 3e-14 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHV ++PE+DLTG G++K YVAV+KGKRISANLPYKVEFV +E+ GR PVKF A Sbjct: 102 LKVYHVVRVPEVDLTGMEGVIKNYVAVWKGKRISANLPYKVEFV-KEIEGRG--PVKFFA 158 Query: 197 H 195 H Sbjct: 159 H 159 >ref|XP_002271306.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Vitis vinifera] gi|147820518|emb|CAN76575.1| hypothetical protein VITISV_024425 [Vitis vinifera] Length = 168 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKV+HVP++PE+DLTG G+LKQYV V+KGKRISANLP+K+ FVA ++ GR PVKF A Sbjct: 99 LKVFHVPRVPEVDLTGMEGVLKQYVGVWKGKRISANLPFKIGFVA-DIEGRG--PVKFFA 155 Query: 197 H 195 H Sbjct: 156 H 156 >ref|XP_006468671.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Citrus sinensis] Length = 160 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/61 (65%), Positives = 49/61 (80%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVP++PE DL+G G+LKQYV V+KGK+ISAN+PYKV FV E +G+PVKF A Sbjct: 94 LKVYHVPRVPEHDLSGMEGVLKQYVGVWKGKKISANMPYKVAFVTE----IEGRPVKFFA 149 Query: 197 H 195 H Sbjct: 150 H 150 >ref|XP_013450699.1| ferredoxin-thioredoxin reductase, variable chain [Medicago truncatula] gi|388513997|gb|AFK45060.1| unknown [Medicago truncatula] gi|657380624|gb|KEH24727.1| ferredoxin-thioredoxin reductase, variable chain [Medicago truncatula] Length = 135 Score = 82.0 bits (201), Expect = 2e-13 Identities = 42/62 (67%), Positives = 50/62 (80%), Gaps = 1/62 (1%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFK-GKRISANLPYKVEFVAEEVSGRDGKPVKFS 201 LKVYHVPK+PE+DLTGR G +KQ V +K KRISANLPYKVEFVA+++ G G P+KF Sbjct: 65 LKVYHVPKVPEVDLTGREGQIKQNVTFWKDNKRISANLPYKVEFVADDIQGPRG-PLKFV 123 Query: 200 AH 195 AH Sbjct: 124 AH 125 >ref|XP_006448508.1| hypothetical protein CICLE_v10017019mg [Citrus clementina] gi|557551119|gb|ESR61748.1| hypothetical protein CICLE_v10017019mg [Citrus clementina] Length = 160 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/61 (65%), Positives = 49/61 (80%) Frame = -1 Query: 377 LKVYHVPKLPEIDLTGRVGLLKQYVAVFKGKRISANLPYKVEFVAEEVSGRDGKPVKFSA 198 LKVYHVP++PE+DL+G G+LKQYV V+KGK+ISANLPYKV FV E +G+ VKF A Sbjct: 94 LKVYHVPRVPELDLSGMEGVLKQYVGVWKGKKISANLPYKVAFVTE----IEGRTVKFFA 149 Query: 197 H 195 H Sbjct: 150 H 150