BLASTX nr result
ID: Perilla23_contig00021847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00021847 (585 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074751.1| PREDICTED: cellulose synthase A catalytic su... 69 2e-09 ref|XP_011101270.1| PREDICTED: cellulose synthase A catalytic su... 67 7e-09 ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic su... 65 3e-08 ref|XP_012080728.1| PREDICTED: cellulose synthase A catalytic su... 65 3e-08 gb|AGV22110.1| cellulose synthase 8 [Betula luminifera] 64 4e-08 gb|EPS73674.1| cellulose synthase catalytic subunit, partial [Ge... 64 4e-08 ref|XP_004290503.1| PREDICTED: cellulose synthase A catalytic su... 64 4e-08 ref|XP_007199689.1| hypothetical protein PRUPE_ppa000559mg [Prun... 64 6e-08 ref|XP_002265955.1| PREDICTED: cellulose synthase A catalytic su... 64 7e-08 ref|XP_010678670.1| PREDICTED: cellulose synthase A catalytic su... 63 1e-07 ref|XP_010680991.1| PREDICTED: cellulose synthase A catalytic su... 63 1e-07 ref|XP_009765335.1| PREDICTED: cellulose synthase A catalytic su... 63 1e-07 ref|XP_009599913.1| PREDICTED: cellulose synthase A catalytic su... 63 1e-07 ref|XP_012839218.1| PREDICTED: cellulose synthase A catalytic su... 63 1e-07 ref|XP_012829515.1| PREDICTED: cellulose synthase A catalytic su... 63 1e-07 ref|XP_014513785.1| PREDICTED: cellulose synthase A catalytic su... 62 2e-07 gb|KRH35122.1| hypothetical protein GLYMA_10G223500 [Glycine max] 62 2e-07 gb|KOM35865.1| hypothetical protein LR48_Vigan02g201500 [Vigna a... 62 2e-07 ref|XP_010260984.1| PREDICTED: cellulose synthase A catalytic su... 62 2e-07 ref|XP_009376550.1| PREDICTED: cellulose synthase A catalytic su... 62 2e-07 >ref|XP_011074751.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Sesamum indicum] Length = 1092 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD Sbjct: 1061 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 1092 >ref|XP_011101270.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Sesamum indicum] Length = 1084 Score = 67.0 bits (162), Expect = 7e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPF+SRDG+VLEVCGLDCD Sbjct: 1053 LLASIFSLLWVRINPFVSRDGLVLEVCGLDCD 1084 >ref|XP_010241683.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nelumbo nucifera] Length = 1095 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPFLS+DG VLEVCGLDCD Sbjct: 1063 LLASIFSLLWVRINPFLSKDGPVLEVCGLDCD 1094 >ref|XP_012080728.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Jatropha curcas] gi|643720354|gb|KDP30751.1| hypothetical protein JCGZ_15180 [Jatropha curcas] Length = 1092 Score = 65.1 bits (157), Expect = 3e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVR+NPFLS+DGIVLE+CGL+CD Sbjct: 1061 LLASIFSLLWVRVNPFLSKDGIVLEICGLNCD 1092 >gb|AGV22110.1| cellulose synthase 8 [Betula luminifera] Length = 1091 Score = 64.3 bits (155), Expect = 4e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPFLSR GIVLEVCGL+CD Sbjct: 1060 LLASIFSLLWVRINPFLSRGGIVLEVCGLNCD 1091 >gb|EPS73674.1| cellulose synthase catalytic subunit, partial [Genlisea aurea] Length = 522 Score = 64.3 bits (155), Expect = 4e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVR+NPFLSRDG+VLEVCGL+C+ Sbjct: 491 LLASIFSLLWVRVNPFLSRDGLVLEVCGLNCE 522 >ref|XP_004290503.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Fragaria vesca subsp. vesca] Length = 1093 Score = 64.3 bits (155), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPF SR GIVLEVCGLDCD Sbjct: 1062 LLASIFSLLWVRINPFASRGGIVLEVCGLDCD 1093 >ref|XP_007199689.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica] gi|645264091|ref|XP_008237530.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Prunus mume] gi|462395089|gb|EMJ00888.1| hypothetical protein PRUPE_ppa000559mg [Prunus persica] Length = 1096 Score = 63.9 bits (154), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPF+S+ GIVLEVCGLDCD Sbjct: 1065 LLASIFSLLWVRINPFVSKGGIVLEVCGLDCD 1096 >ref|XP_002265955.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] [Vitis vinifera] Length = 1096 Score = 63.5 bits (153), Expect = 7e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVR+NPF+S+ GIVLEVCGLDCD Sbjct: 1065 LLASIFSLLWVRVNPFVSKGGIVLEVCGLDCD 1096 >ref|XP_010678670.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Beta vulgaris subsp. vulgaris] gi|870859022|gb|KMT10486.1| hypothetical protein BVRB_5g116100 [Beta vulgaris subsp. vulgaris] Length = 1102 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPF +R GIVLEVCGLDCD Sbjct: 1071 LLASIFSLLWVRINPFTARGGIVLEVCGLDCD 1102 >ref|XP_010680991.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Beta vulgaris subsp. vulgaris] gi|870868765|gb|KMT19568.1| hypothetical protein BVRB_1g011870 [Beta vulgaris subsp. vulgaris] Length = 1102 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPF +R GIVLEVCGLDCD Sbjct: 1071 LLASIFSLLWVRINPFTARGGIVLEVCGLDCD 1102 >ref|XP_009765335.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nicotiana sylvestris] Length = 1084 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASI SLLWVRINPF+SRDG+VLEVCGLDC+ Sbjct: 1053 LLASILSLLWVRINPFVSRDGLVLEVCGLDCE 1084 >ref|XP_009599913.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nicotiana tomentosiformis] Length = 1084 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASI SLLWVRINPF+SRDG+VLEVCGLDC+ Sbjct: 1053 LLASILSLLWVRINPFVSRDGLVLEVCGLDCE 1084 >ref|XP_012839218.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like [Erythranthe guttatus] gi|604331975|gb|EYU36833.1| hypothetical protein MIMGU_mgv1a000540mg [Erythranthe guttata] Length = 1087 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPFL+R GIVLEVCGLDC+ Sbjct: 1056 LLASIFSLLWVRINPFLARGGIVLEVCGLDCN 1087 >ref|XP_012829515.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like [Erythranthe guttatus] gi|604297217|gb|EYU17481.1| hypothetical protein MIMGU_mgv1a000527mg [Erythranthe guttata] Length = 1093 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPF+SR G+VLEVCGLDC+ Sbjct: 1062 LLASIFSLLWVRINPFVSRGGVVLEVCGLDCN 1093 >ref|XP_014513785.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Vigna radiata var. radiata] Length = 1093 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPFLS+D IVLE+CGL+CD Sbjct: 1062 LLASIFSLLWVRINPFLSKDDIVLELCGLNCD 1093 >gb|KRH35122.1| hypothetical protein GLYMA_10G223500 [Glycine max] Length = 1097 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPFLS+ GIVLE+CGL+CD Sbjct: 1066 LLASIFSLLWVRINPFLSKGGIVLELCGLNCD 1097 >gb|KOM35865.1| hypothetical protein LR48_Vigan02g201500 [Vigna angularis] Length = 1093 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPFLS+D IVLE+CGL+CD Sbjct: 1062 LLASIFSLLWVRINPFLSKDDIVLELCGLNCD 1093 >ref|XP_010260984.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Nelumbo nucifera] Length = 1093 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPFL++ GIVLEVCGL+CD Sbjct: 1061 LLASIFSLLWVRINPFLAKGGIVLEVCGLNCD 1092 >ref|XP_009376550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Pyrus x bretschneideri] Length = 1095 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 584 LLASIFSLLWVRINPFLSRDGIVLEVCGLDCD 489 LLASIFSLLWVRINPF+S+ GIVLEVCGLDC+ Sbjct: 1064 LLASIFSLLWVRINPFVSKGGIVLEVCGLDCN 1095