BLASTX nr result
ID: Perilla23_contig00021599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00021599 (347 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094637.1| PREDICTED: probable receptor-like protein ki... 61 4e-07 ref|XP_011094636.1| PREDICTED: probable receptor-like protein ki... 61 4e-07 >ref|XP_011094637.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X2 [Sesamum indicum] gi|747093646|ref|XP_011094638.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X2 [Sesamum indicum] gi|747093648|ref|XP_011094639.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X2 [Sesamum indicum] Length = 425 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 345 KNKEQKAEESEPKGKRRISDIKFVDSSWLLRVWSSKLVKTC 223 K +++K EE E KGKRRI+D+K D WL+RVWSSKLVKTC Sbjct: 385 KEQKKKFEEPEAKGKRRIADMKIGDGGWLVRVWSSKLVKTC 425 >ref|XP_011094636.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X1 [Sesamum indicum] Length = 436 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 345 KNKEQKAEESEPKGKRRISDIKFVDSSWLLRVWSSKLVKTC 223 K +++K EE E KGKRRI+D+K D WL+RVWSSKLVKTC Sbjct: 396 KEQKKKFEEPEAKGKRRIADMKIGDGGWLVRVWSSKLVKTC 436