BLASTX nr result
ID: Perilla23_contig00021348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00021348 (677 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIE89803.1| SQUAMOSA promoter binding protein-like 14, partia... 115 2e-23 ref|XP_009764314.1| PREDICTED: squamosa promoter-binding-like pr... 111 4e-22 ref|XP_009621039.1| PREDICTED: squamosa promoter-binding-like pr... 111 4e-22 ref|XP_009621034.1| PREDICTED: squamosa promoter-binding-like pr... 111 4e-22 ref|XP_006352164.1| PREDICTED: squamosa promoter-binding-like pr... 111 4e-22 ref|XP_004239238.1| PREDICTED: squamosa promoter-binding-like pr... 111 4e-22 ref|XP_012849834.1| PREDICTED: squamosa promoter-binding-like pr... 110 6e-22 gb|EYU26977.1| hypothetical protein MIMGU_mgv1a0145091mg, partia... 110 6e-22 emb|CDP13362.1| unnamed protein product [Coffea canephora] 106 2e-20 gb|ALN97010.1| hypothetical protein [Populus tomentosa] 105 2e-20 ref|XP_002318746.1| hypothetical protein POPTR_0012s10260g [Popu... 105 2e-20 ref|XP_011023967.1| PREDICTED: squamosa promoter-binding-like pr... 105 3e-20 ref|XP_002322273.2| hypothetical protein POPTR_0015s11100g [Popu... 105 3e-20 gb|KNA15434.1| hypothetical protein SOVF_098310 [Spinacia oleracea] 104 4e-20 gb|KCW49106.1| hypothetical protein EUGRSUZ_K02708 [Eucalyptus g... 104 4e-20 ref|XP_010037393.1| PREDICTED: squamosa promoter-binding-like pr... 104 4e-20 ref|XP_010682726.1| PREDICTED: squamosa promoter-binding-like pr... 103 7e-20 ref|XP_007043940.1| Squamosa promoter-binding protein transcript... 103 7e-20 gb|KHG00841.1| Squamosa promoter-binding-like protein 16 [Gossyp... 103 1e-19 gb|AIL95864.1| SQUAMOSA promoter binding-like transcription fact... 103 1e-19 >gb|AIE89803.1| SQUAMOSA promoter binding protein-like 14, partial [Salvia miltiorrhiza] Length = 225 Score = 115 bits (288), Expect = 2e-23 Identities = 52/68 (76%), Positives = 55/68 (80%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR K P + HCLVDGC ADLS+CRDYHRRHKVCE HSKTPKVTIGGR+QRFCQ Sbjct: 8 KRAKAP---ANVVQVAHCLVDGCSADLSVCRDYHRRHKVCEAHSKTPKVTIGGREQRFCQ 64 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 65 QCSRFHSL 72 >ref|XP_009764314.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana sylvestris] gi|698535847|ref|XP_009764315.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana sylvestris] gi|698535850|ref|XP_009764316.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana sylvestris] gi|698535853|ref|XP_009764317.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana sylvestris] Length = 329 Score = 111 bits (278), Expect = 4e-22 Identities = 51/68 (75%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR K P + HCLVDGC+ADLS CR+YHRRHKVCE HSKT KVTIGGRDQRFCQ Sbjct: 12 KRAKAPGNIA---QVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQRFCQ 68 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 69 QCSRFHSL 76 >ref|XP_009621039.1| PREDICTED: squamosa promoter-binding-like protein 16 isoform X2 [Nicotiana tomentosiformis] Length = 310 Score = 111 bits (278), Expect = 4e-22 Identities = 51/68 (75%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR K P + HCLVDGC+ADLS CR+YHRRHKVCE HSKT KVTIGGRDQRFCQ Sbjct: 8 KRAKAPGNIA---QVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQRFCQ 64 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 65 QCSRFHSL 72 >ref|XP_009621034.1| PREDICTED: squamosa promoter-binding-like protein 16 isoform X1 [Nicotiana tomentosiformis] gi|697133970|ref|XP_009621035.1| PREDICTED: squamosa promoter-binding-like protein 16 isoform X1 [Nicotiana tomentosiformis] gi|697133972|ref|XP_009621036.1| PREDICTED: squamosa promoter-binding-like protein 16 isoform X1 [Nicotiana tomentosiformis] gi|697133974|ref|XP_009621037.1| PREDICTED: squamosa promoter-binding-like protein 16 isoform X1 [Nicotiana tomentosiformis] gi|697133976|ref|XP_009621038.1| PREDICTED: squamosa promoter-binding-like protein 16 isoform X1 [Nicotiana tomentosiformis] Length = 326 Score = 111 bits (278), Expect = 4e-22 Identities = 51/68 (75%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR K P + HCLVDGC+ADLS CR+YHRRHKVCE HSKT KVTIGGRDQRFCQ Sbjct: 8 KRAKAPGNIA---QVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQRFCQ 64 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 65 QCSRFHSL 72 >ref|XP_006352164.1| PREDICTED: squamosa promoter-binding-like protein 16-like isoform X1 [Solanum tuberosum] gi|565371134|ref|XP_006352165.1| PREDICTED: squamosa promoter-binding-like protein 16-like isoform X2 [Solanum tuberosum] gi|565371136|ref|XP_006352166.1| PREDICTED: squamosa promoter-binding-like protein 16-like isoform X3 [Solanum tuberosum] Length = 319 Score = 111 bits (278), Expect = 4e-22 Identities = 52/68 (76%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR K P NI HCLVDGC+ADLS CR+YHRRHKVCE HSKT KVTI GRDQRFCQ Sbjct: 11 KRAKAPG------NIAHCLVDGCNADLSECREYHRRHKVCEVHSKTAKVTIAGRDQRFCQ 64 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 65 QCSRFHSL 72 >ref|XP_004239238.1| PREDICTED: squamosa promoter-binding-like protein 13A [Solanum lycopersicum] gi|460387124|ref|XP_004239239.1| PREDICTED: squamosa promoter-binding-like protein 13A [Solanum lycopersicum] gi|723699423|ref|XP_010321016.1| PREDICTED: squamosa promoter-binding-like protein 13A [Solanum lycopersicum] gi|723699426|ref|XP_010321017.1| PREDICTED: squamosa promoter-binding-like protein 13A [Solanum lycopersicum] gi|723699433|ref|XP_010321018.1| PREDICTED: squamosa promoter-binding-like protein 13A [Solanum lycopersicum] Length = 312 Score = 111 bits (278), Expect = 4e-22 Identities = 52/68 (76%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR K P NI HCLVDGC+ADLS CR+YHRRHKVCE HSKT KVTI GRDQRFCQ Sbjct: 9 KRAKAPG------NIAHCLVDGCNADLSECREYHRRHKVCEVHSKTAKVTIAGRDQRFCQ 62 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 63 QCSRFHSL 70 >ref|XP_012849834.1| PREDICTED: squamosa promoter-binding-like protein 13A, partial [Erythranthe guttatus] Length = 152 Score = 110 bits (276), Expect = 6e-22 Identities = 51/68 (75%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR + P I HCLVDGC+ADLSLCRDYHRRHKVCE HSKT KVTIGGR+ RFCQ Sbjct: 6 KRARAPGNMT---QIAHCLVDGCNADLSLCRDYHRRHKVCETHSKTSKVTIGGRELRFCQ 62 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 63 QCSRFHSL 70 >gb|EYU26977.1| hypothetical protein MIMGU_mgv1a0145091mg, partial [Erythranthe guttata] gi|604314004|gb|EYU26978.1| hypothetical protein MIMGU_mgv1a0145091mg, partial [Erythranthe guttata] Length = 153 Score = 110 bits (276), Expect = 6e-22 Identities = 51/68 (75%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR + P I HCLVDGC+ADLSLCRDYHRRHKVCE HSKT KVTIGGR+ RFCQ Sbjct: 6 KRARAPGNMT---QIAHCLVDGCNADLSLCRDYHRRHKVCETHSKTSKVTIGGRELRFCQ 62 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 63 QCSRFHSL 70 >emb|CDP13362.1| unnamed protein product [Coffea canephora] Length = 323 Score = 106 bits (264), Expect = 2e-20 Identities = 49/68 (72%), Positives = 52/68 (76%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR K P + HCLVDGC+ADLS CRDYHRRHKVCE HSK KVTIGGR+ RFCQ Sbjct: 11 KRAKAPGNVT---QMAHCLVDGCNADLSQCRDYHRRHKVCEHHSKASKVTIGGRELRFCQ 67 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 68 QCSRFHSL 75 >gb|ALN97010.1| hypothetical protein [Populus tomentosa] Length = 347 Score = 105 bits (263), Expect = 2e-20 Identities = 48/68 (70%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR +G N + CLVDGC++DLS CRDYHRRHKVCE HSKTP+VTIGG+ QRFCQ Sbjct: 96 KRARGANNGT---QVAMCLVDGCNSDLSTCRDYHRRHKVCELHSKTPQVTIGGQKQRFCQ 152 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 153 QCSRFHSL 160 >ref|XP_002318746.1| hypothetical protein POPTR_0012s10260g [Populus trichocarpa] gi|222859419|gb|EEE96966.1| hypothetical protein POPTR_0012s10260g [Populus trichocarpa] Length = 346 Score = 105 bits (263), Expect = 2e-20 Identities = 48/68 (70%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR +G N + CLVDGC++DLS CRDYHRRHKVCE HSKTP+VTIGG+ QRFCQ Sbjct: 96 KRARGANNGT---QVAMCLVDGCNSDLSTCRDYHRRHKVCELHSKTPQVTIGGQKQRFCQ 152 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 153 QCSRFHSL 160 >ref|XP_011023967.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] gi|743831126|ref|XP_011023968.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] gi|743831130|ref|XP_011023969.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] gi|743831134|ref|XP_011023970.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] gi|743831138|ref|XP_011023971.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] gi|743831142|ref|XP_011023973.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] gi|743831146|ref|XP_011023974.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] gi|743831150|ref|XP_011023975.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] gi|743831154|ref|XP_011023976.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] gi|743831158|ref|XP_011023977.1| PREDICTED: squamosa promoter-binding-like protein 13A [Populus euphratica] Length = 381 Score = 105 bits (262), Expect = 3e-20 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR +G N + CLVDGC++DLS CRDYHRRHKVCE HSKTP+VT+GG+ QRFCQ Sbjct: 80 KRARGANSGT---QVAMCLVDGCNSDLSTCRDYHRRHKVCELHSKTPQVTVGGQKQRFCQ 136 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 137 QCSRFHSL 144 >ref|XP_002322273.2| hypothetical protein POPTR_0015s11100g [Populus trichocarpa] gi|550322466|gb|EEF06400.2| hypothetical protein POPTR_0015s11100g [Populus trichocarpa] Length = 381 Score = 105 bits (262), Expect = 3e-20 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR +G N + CLVDGC++DLS CRDYHRRHKVCE HSKTP+VT+GG+ QRFCQ Sbjct: 80 KRARGANSGT---QVAMCLVDGCNSDLSTCRDYHRRHKVCELHSKTPQVTVGGQKQRFCQ 136 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 137 QCSRFHSL 144 >gb|KNA15434.1| hypothetical protein SOVF_098310 [Spinacia oleracea] Length = 394 Score = 104 bits (260), Expect = 4e-20 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -3 Query: 153 CLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQQCSRFHSL 1 CLVDGC ADLS CRDYHRRHKVCE HSKTP+VTIGG +QRFCQQCSRFHSL Sbjct: 95 CLVDGCKADLSKCRDYHRRHKVCEMHSKTPRVTIGGHEQRFCQQCSRFHSL 145 >gb|KCW49106.1| hypothetical protein EUGRSUZ_K02708 [Eucalyptus grandis] Length = 315 Score = 104 bits (260), Expect = 4e-20 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = -3 Query: 156 HCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQQCSRFHSL 1 HCLVDGC+ADLS CR+YHRRHKVCE HSKTP+VTI GR QRFCQQCSRFHSL Sbjct: 42 HCLVDGCNADLSNCREYHRRHKVCEVHSKTPEVTINGRKQRFCQQCSRFHSL 93 >ref|XP_010037393.1| PREDICTED: squamosa promoter-binding-like protein 13A [Eucalyptus grandis] gi|702497054|ref|XP_010037395.1| PREDICTED: squamosa promoter-binding-like protein 13A [Eucalyptus grandis] gi|702497057|ref|XP_010037396.1| PREDICTED: squamosa promoter-binding-like protein 13A [Eucalyptus grandis] gi|702497061|ref|XP_010037397.1| PREDICTED: squamosa promoter-binding-like protein 13A [Eucalyptus grandis] gi|702497065|ref|XP_010037398.1| PREDICTED: squamosa promoter-binding-like protein 13A [Eucalyptus grandis] gi|629082659|gb|KCW49104.1| hypothetical protein EUGRSUZ_K02708 [Eucalyptus grandis] gi|629082660|gb|KCW49105.1| hypothetical protein EUGRSUZ_K02708 [Eucalyptus grandis] Length = 363 Score = 104 bits (260), Expect = 4e-20 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = -3 Query: 156 HCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQQCSRFHSL 1 HCLVDGC+ADLS CR+YHRRHKVCE HSKTP+VTI GR QRFCQQCSRFHSL Sbjct: 90 HCLVDGCNADLSNCREYHRRHKVCEVHSKTPEVTINGRKQRFCQQCSRFHSL 141 >ref|XP_010682726.1| PREDICTED: squamosa promoter-binding-like protein 16 [Beta vulgaris subsp. vulgaris] gi|731343106|ref|XP_010682727.1| PREDICTED: squamosa promoter-binding-like protein 16 [Beta vulgaris subsp. vulgaris] gi|870855712|gb|KMT07428.1| hypothetical protein BVRB_6g150510 [Beta vulgaris subsp. vulgaris] Length = 386 Score = 103 bits (258), Expect = 7e-20 Identities = 47/65 (72%), Positives = 49/65 (75%) Frame = -3 Query: 195 KGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQQCS 16 K P + CLVDGC ADLS CRDYHRRHKVCE HSKTP+VTIGG QRFCQQCS Sbjct: 83 KRPRIPSSGGQVVSCLVDGCKADLSKCRDYHRRHKVCEMHSKTPRVTIGGNVQRFCQQCS 142 Query: 15 RFHSL 1 RFHSL Sbjct: 143 RFHSL 147 >ref|XP_007043940.1| Squamosa promoter-binding protein transcription factor family protein, putative isoform 1 [Theobroma cacao] gi|508707875|gb|EOX99771.1| Squamosa promoter-binding protein transcription factor family protein, putative isoform 1 [Theobroma cacao] Length = 329 Score = 103 bits (258), Expect = 7e-20 Identities = 48/68 (70%), Positives = 52/68 (76%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR + P + CLVDGC ADLS CRDYHRRHKVCE HSKTPKVTI G++QRFCQ Sbjct: 29 KRARAPGSGN---QVPSCLVDGCTADLSKCRDYHRRHKVCEVHSKTPKVTIRGQEQRFCQ 85 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 86 QCSRFHSL 93 >gb|KHG00841.1| Squamosa promoter-binding-like protein 16 [Gossypium arboreum] Length = 302 Score = 103 bits (257), Expect = 1e-19 Identities = 48/68 (70%), Positives = 52/68 (76%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR + P + CLVDGC ADLS CRDYHRRHKVCE HSKTPKVTI G++QRFCQ Sbjct: 10 KRARAP---ATGNQVPSCLVDGCTADLSKCRDYHRRHKVCEVHSKTPKVTIRGQEQRFCQ 66 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 67 QCSRFHSL 74 >gb|AIL95864.1| SQUAMOSA promoter binding-like transcription factor [Gossypium hirsutum] Length = 302 Score = 103 bits (257), Expect = 1e-19 Identities = 48/68 (70%), Positives = 52/68 (76%) Frame = -3 Query: 204 KRGKGPNXXXXXANIGHCLVDGCDADLSLCRDYHRRHKVCEPHSKTPKVTIGGRDQRFCQ 25 KR + P + CLVDGC ADLS CRDYHRRHKVCE HSKTPKVTI G++QRFCQ Sbjct: 10 KRARAP---ATGNQVPSCLVDGCTADLSKCRDYHRRHKVCEVHSKTPKVTIRGQEQRFCQ 66 Query: 24 QCSRFHSL 1 QCSRFHSL Sbjct: 67 QCSRFHSL 74