BLASTX nr result
ID: Perilla23_contig00020917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00020917 (322 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080627.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_012843972.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 gb|EYU46046.1| hypothetical protein MIMGU_mgv1a005800mg [Erythra... 59 1e-06 ref|XP_007138515.1| hypothetical protein PHAVU_009G215700g [Phas... 59 1e-06 ref|XP_004516335.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_010258859.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_006299538.1| hypothetical protein CARUB_v10015710mg [Caps... 59 2e-06 ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_009804649.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_002512558.1| pentatricopeptide repeat-containing protein,... 58 2e-06 ref|XP_006366604.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_010327482.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_003598203.1| PPR containing plant-like protein [Medicago ... 58 2e-06 ref|XP_012454370.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_008229017.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 gb|KDO51630.1| hypothetical protein CISIN_1g021829mg [Citrus sin... 58 3e-06 gb|KDO39423.1| hypothetical protein CISIN_1g022131mg [Citrus sin... 58 3e-06 ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citr... 58 3e-06 ref|XP_004306198.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_007198972.1| hypothetical protein PRUPE_ppa015078mg [Prun... 58 3e-06 >ref|XP_011080627.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Sesamum indicum] Length = 540 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKLEEESITFGSEF EYHL PYKR Sbjct: 509 LRTWRRLKKKLEEESITFGSEFKEYHLKPYKR 540 >ref|XP_012843972.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Erythranthe guttatus] Length = 549 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKLEEESITF SEF EYHL PY R Sbjct: 518 LRTWRRLKKKLEEESITFSSEFKEYHLKPYNR 549 >gb|EYU46046.1| hypothetical protein MIMGU_mgv1a005800mg [Erythranthe guttata] Length = 470 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKLEEESITF SEF EYHL PY R Sbjct: 439 LRTWRRLKKKLEEESITFSSEFKEYHLKPYNR 470 >ref|XP_007138515.1| hypothetical protein PHAVU_009G215700g [Phaseolus vulgaris] gi|561011602|gb|ESW10509.1| hypothetical protein PHAVU_009G215700g [Phaseolus vulgaris] Length = 509 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKL+EESITFGSEF YHL PY+R Sbjct: 478 LRTWRRLKKKLDEESITFGSEFQNYHLKPYRR 509 >ref|XP_004516335.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Cicer arietinum] Length = 512 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKL+EESITFGSEF YHL PY+R Sbjct: 481 LRTWRRLKKKLDEESITFGSEFQNYHLKPYRR 512 >ref|XP_010258859.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nelumbo nucifera] gi|720009185|ref|XP_010258860.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nelumbo nucifera] gi|720009188|ref|XP_010258863.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nelumbo nucifera] gi|720009191|ref|XP_010258864.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nelumbo nucifera] Length = 531 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKLEEES+TFGSEF YH PY+R Sbjct: 500 LRTWRRLKKKLEEESVTFGSEFQRYHFKPYRR 531 >ref|XP_006299538.1| hypothetical protein CARUB_v10015710mg [Capsella rubella] gi|482568247|gb|EOA32436.1| hypothetical protein CARUB_v10015710mg [Capsella rubella] Length = 506 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWRMLKKKL+EESITFGSEF Y +PYKR Sbjct: 475 LRTWRMLKKKLDEESITFGSEFQRYPFEPYKR 506 >ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|731387719|ref|XP_010649356.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|731387721|ref|XP_010649357.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|296088528|emb|CBI37519.3| unnamed protein product [Vitis vinifera] Length = 525 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 L+TWR LKKKLEEESITFGSEF +YH PY+R Sbjct: 494 LKTWRRLKKKLEEESITFGSEFQQYHFKPYRR 525 >ref|XP_009804649.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nicotiana sylvestris] Length = 530 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKK+L+EESITFGSEF YHL PY+R Sbjct: 499 LRTWRRLKKRLDEESITFGSEFENYHLKPYRR 530 >ref|XP_002512558.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548519|gb|EEF50010.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 511 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKL+EESI FGSEF+ YHL PY+R Sbjct: 480 LRTWRRLKKKLDEESIAFGSEFSNYHLKPYRR 511 >ref|XP_006366604.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565402271|ref|XP_006366605.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565402273|ref|XP_006366606.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 520 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKK+L+EESITFGSEF YHL PY+R Sbjct: 489 LRTWRRLKKRLDEESITFGSEFENYHLKPYRR 520 >ref|XP_010327482.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum lycopersicum] gi|723736652|ref|XP_010327483.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Solanum lycopersicum] Length = 532 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKK+L+EESITFGSEF YHL PY+R Sbjct: 501 LRTWRRLKKRLDEESITFGSEFENYHLKPYRR 532 >ref|XP_003598203.1| PPR containing plant-like protein [Medicago truncatula] gi|355487251|gb|AES68454.1| PPR containing plant-like protein [Medicago truncatula] Length = 503 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKK+L++ESITFGSEF YHL PYKR Sbjct: 472 LRTWRRLKKRLDQESITFGSEFQNYHLKPYKR 503 >ref|XP_012454370.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Gossypium raimondii] gi|763806355|gb|KJB73293.1| hypothetical protein B456_011G226000 [Gossypium raimondii] Length = 525 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR +KKKL+EESITFGSEF +YH PY+R Sbjct: 494 LRTWRRIKKKLDEESITFGSEFQDYHFKPYRR 525 >ref|XP_008229017.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Prunus mume] Length = 523 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKL+EESI+FGSEF YHL PY+R Sbjct: 492 LRTWRRLKKKLDEESISFGSEFQNYHLKPYRR 523 >gb|KDO51630.1| hypothetical protein CISIN_1g021829mg [Citrus sinensis] gi|641832600|gb|KDO51631.1| hypothetical protein CISIN_1g021829mg [Citrus sinensis] Length = 307 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKL+EESITFGSEF YH PY+R Sbjct: 276 LRTWRRLKKKLDEESITFGSEFQNYHFKPYRR 307 >gb|KDO39423.1| hypothetical protein CISIN_1g022131mg [Citrus sinensis] Length = 302 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKL+EESITFGSEF YH PY+R Sbjct: 271 LRTWRRLKKKLDEESITFGSEFQNYHFKPYRR 302 >ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|567879147|ref|XP_006432132.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|568821248|ref|XP_006465094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X1 [Citrus sinensis] gi|568821250|ref|XP_006465095.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like isoform X2 [Citrus sinensis] gi|557534253|gb|ESR45371.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|557534254|gb|ESR45372.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] Length = 540 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKL+EESITFGSEF YH PY+R Sbjct: 509 LRTWRRLKKKLDEESITFGSEFQNYHFKPYRR 540 >ref|XP_004306198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 501 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKL+EES+TFG+EF YHL PY+R Sbjct: 470 LRTWRRLKKKLDEESVTFGAEFQNYHLKPYRR 501 >ref|XP_007198972.1| hypothetical protein PRUPE_ppa015078mg [Prunus persica] gi|462394267|gb|EMJ00171.1| hypothetical protein PRUPE_ppa015078mg [Prunus persica] Length = 480 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 LRTWRMLKKKLEEESITFGSEFAEYHLDPYKR 97 LRTWR LKKKL+EESI+FGSEF YHL PY+R Sbjct: 449 LRTWRRLKKKLDEESISFGSEFQNYHLKPYRR 480