BLASTX nr result
ID: Perilla23_contig00020856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00020856 (598 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012833248.1| PREDICTED: cyclin-P3-1-like isoform X1 [Eryt... 61 5e-07 gb|EYU40931.1| hypothetical protein MIMGU_mgv1a0134081mg, partia... 61 5e-07 >ref|XP_012833248.1| PREDICTED: cyclin-P3-1-like isoform X1 [Erythranthe guttatus] gi|848865067|ref|XP_012833249.1| PREDICTED: cyclin-P3-1-like isoform X2 [Erythranthe guttatus] Length = 221 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -3 Query: 119 MGTLAYEPKIMCPLDYVTLGLKDPIKDYLGKPRVLSLLS 3 MG+LA E +I+ LDY++LGLKDPIKDY+GKPRVLSL+S Sbjct: 1 MGSLALEKEIIGSLDYISLGLKDPIKDYIGKPRVLSLVS 39 >gb|EYU40931.1| hypothetical protein MIMGU_mgv1a0134081mg, partial [Erythranthe guttata] gi|604341686|gb|EYU40932.1| hypothetical protein MIMGU_mgv1a018676mg [Erythranthe guttata] Length = 137 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -3 Query: 119 MGTLAYEPKIMCPLDYVTLGLKDPIKDYLGKPRVLSLLS 3 MG+LA E +I+ LDY++LGLKDPIKDY+GKPRVLSL+S Sbjct: 1 MGSLALEKEIIGSLDYISLGLKDPIKDYIGKPRVLSLVS 39