BLASTX nr result
ID: Perilla23_contig00020591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00020591 (403 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097741.1| PREDICTED: 25S rRNA (cytosine-C(5))-methyltr... 62 1e-07 >ref|XP_011097741.1| PREDICTED: 25S rRNA (cytosine-C(5))-methyltransferase nop2-like [Sesamum indicum] Length = 639 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/51 (54%), Positives = 40/51 (78%) Frame = +2 Query: 107 MAGPKLNKKKGGRAVNPPARKNKKTLSTPEKESEKEDLISNSDGSEEPKIL 259 MAGPKL +KKG +A++ P RK +K + E+ESEKE+L+S+SDG +EP+ L Sbjct: 1 MAGPKLGRKKGAKAISHPPRKKQKAVLPVEEESEKEELLSDSDGKDEPEKL 51 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = +2 Query: 266 AGSKLNKKKGSRAVNPPPRKKQKAVPTLEKEPEEEDLISNSDGSEE 403 AG KL +KKG++A++ PPRKKQKAV +E+E E+E+L+S+SDG +E Sbjct: 2 AGPKLGRKKGAKAISHPPRKKQKAVLPVEEESEKEELLSDSDGKDE 47