BLASTX nr result
ID: Perilla23_contig00020325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00020325 (651 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071377.1| PREDICTED: phytochrome B [Sesamum indicum] 64 6e-08 >ref|XP_011071377.1| PREDICTED: phytochrome B [Sesamum indicum] Length = 1146 Score = 64.3 bits (155), Expect = 6e-08 Identities = 38/66 (57%), Positives = 44/66 (66%), Gaps = 4/66 (6%) Frame = -3 Query: 187 MAASGRRESQGNSYHNS----QAQSSGTSQHHXXXXXXXXXXXRGGESVSVSKAIAQFTV 20 M ASGRR + GN++ NS QAQSSGTS HH RGG+S+S KA+AQFTV Sbjct: 1 MTASGRRGTHGNNHQNSRALSQAQSSGTSPHHNSNVNNSPSMNRGGDSMS--KAVAQFTV 58 Query: 19 DARLHA 2 DARLHA Sbjct: 59 DARLHA 64