BLASTX nr result
ID: Perilla23_contig00020197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00020197 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012855463.1| PREDICTED: serine/threonine-protein kinase r... 57 7e-06 ref|XP_012839016.1| PREDICTED: serine/threonine-protein kinase r... 57 7e-06 gb|EYU22366.1| hypothetical protein MIMGU_mgv1a0228111mg, partia... 57 7e-06 >ref|XP_012855463.1| PREDICTED: serine/threonine-protein kinase rio2-like [Erythranthe guttatus] Length = 315 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 309 RRAMTSRNSYKDKGGRSSNNSKIHKQLSNW 220 RR +TSRNSYKDKGG+SS NSK+HKQLS+W Sbjct: 286 RRVVTSRNSYKDKGGKSSQNSKLHKQLSSW 315 >ref|XP_012839016.1| PREDICTED: serine/threonine-protein kinase rio2 [Erythranthe guttatus] gi|604331765|gb|EYU36623.1| hypothetical protein MIMGU_mgv1a005879mg [Erythranthe guttata] Length = 466 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 309 RRAMTSRNSYKDKGGRSSNNSKIHKQLSNW 220 RR +TSRNSYKDKGG+SS NSK+HKQLS+W Sbjct: 437 RRVVTSRNSYKDKGGKSSQNSKLHKQLSSW 466 >gb|EYU22366.1| hypothetical protein MIMGU_mgv1a0228111mg, partial [Erythranthe guttata] Length = 136 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 309 RRAMTSRNSYKDKGGRSSNNSKIHKQLSNW 220 RR +TSRNSYKDKGG+SS NSK+HKQLS+W Sbjct: 107 RRVVTSRNSYKDKGGKSSQNSKLHKQLSSW 136