BLASTX nr result
ID: Perilla23_contig00019290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00019290 (609 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849948.1| PREDICTED: uncharacterized protein LOC105969... 64 6e-08 gb|KDP23677.1| hypothetical protein JCGZ_23510 [Jatropha curcas] 57 8e-06 >ref|XP_012849948.1| PREDICTED: uncharacterized protein LOC105969723 [Erythranthe guttatus] gi|604313805|gb|EYU26856.1| hypothetical protein MIMGU_mgv1a013107mg [Erythranthe guttata] Length = 230 Score = 63.9 bits (154), Expect = 6e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -3 Query: 607 RGDDPQHVKTKLRHWAQAVACSVLQSPIRGGGMD*QIFRERK 482 RGDDPQ VKTKLRHWAQAVACSVLQSP+R GMD +E++ Sbjct: 190 RGDDPQQVKTKLRHWAQAVACSVLQSPLR-SGMDFMAEKEKE 230 >gb|KDP23677.1| hypothetical protein JCGZ_23510 [Jatropha curcas] Length = 185 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 604 GDDPQHVKTKLRHWAQAVACSVLQS 530 GDDPQHVKTKLRHWAQAVACSVLQS Sbjct: 160 GDDPQHVKTKLRHWAQAVACSVLQS 184