BLASTX nr result
ID: Perilla23_contig00019192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00019192 (507 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095149.1| PREDICTED: phospholipid-transporting ATPase ... 59 1e-06 ref|XP_006429597.1| hypothetical protein CICLE_v10010927mg [Citr... 57 7e-06 >ref|XP_011095149.1| PREDICTED: phospholipid-transporting ATPase 1-like [Sesamum indicum] Length = 1313 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 506 IFKVCHQIFWPSDIQIAREAEILRKGRKFSGSNADQVSS 390 I KV +QIFWPSDIQIARE+EILR+ R++ GS AD VSS Sbjct: 1275 IVKVFYQIFWPSDIQIARESEILRRRRRYFGSKADHVSS 1313 >ref|XP_006429597.1| hypothetical protein CICLE_v10010927mg [Citrus clementina] gi|568855216|ref|XP_006481204.1| PREDICTED: phospholipid-transporting ATPase 1-like [Citrus sinensis] gi|557531654|gb|ESR42837.1| hypothetical protein CICLE_v10010927mg [Citrus clementina] Length = 1264 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 506 IFKVCHQIFWPSDIQIAREAEILRKGRKFSGSNADQVS 393 +FKV Q FWPSDIQIAREAE+LRKG + ADQVS Sbjct: 1226 LFKVVQQYFWPSDIQIAREAEVLRKGSNYLAPQADQVS 1263