BLASTX nr result
ID: Perilla23_contig00019085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00019085 (348 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012833863.1| PREDICTED: putative disease resistance RPP13... 58 2e-06 >ref|XP_012833863.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Erythranthe guttatus] gi|604340986|gb|EYU40383.1| hypothetical protein MIMGU_mgv1a001106mg [Erythranthe guttata] Length = 888 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = -1 Query: 234 MAEVAVTILLEEVEEVFKWHEDQIYGSENEFGVLKDDLHLLKAFLIDTRIKLEGGEVFRE 55 MAE A+T LLE ++++ H I G+E E L+++L L+KAFL+ + + E GE+FR+ Sbjct: 1 MAEAAITFLLENLQKLLSDHVHLISGAEGELKQLQNELDLMKAFLVQSANRREKGELFRQ 60 Query: 54 IERRIRYMVRK 22 E +IR +V + Sbjct: 61 FETQIRDVVHE 71